Periaxin Antibody - BSA Free

Immunohistochemistry-Frozen: Periaxin Antibody [NBP1-89598] - Staining of Periaxin in mouse sciatic nerve using anti-Periaxin antibody (green). Image from verified customer review.

Analysis in human lung and liver tissues using NBP1-89598 antibody. Corresponding PRX RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Periaxin Antibody [NBP1-89598] - Staining of human lung shows strong membranous positivity in pneumocytes.

Immunohistochemistry-Paraffin: Periaxin Antibody [NBP1-89598] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: Periaxin Antibody [NBP1-89598] - Staining of human kidney shows strong membranous positivity in cells in glomeruli.

Immunohistochemistry-Paraffin: Periaxin Antibody [NBP1-89598] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.

• Reactivity: Hu, Mu, Ca
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Periaxin Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MKVPDMKLPEIKLPKVPEMAVPDVHLPEVQLPKVSEIRLPEMQVPKVPDVHLPKAPEVKLPRAPEVQLKATKAEQAEGMEFGFKMPKMTMPKLGRAESPSRGKPGEAGAEVSGKLVTLPCLQPEVDGEAHVGVPSLTLPSVELDL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRX
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence Reactivity reported in (PMID: 26196511)
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Frozen Validated from a verified customer review.
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Periaxin Protein (NBP1-89598PEP)

Reactivity Notes

Canine reactivity reported in scientific literature (PMID: 26196511). Mouse reactivity reported from a verified customer review.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Periaxin Antibody - BSA Free

• CMT4F
• PRX

Background

Periaxin is involved in peripheral nerve myelin upkeep. The encoded protein contains 2 PDZ domains which were named after PSD95 (post synaptic density protein), DlgA (Drosophila disc large tumor suppressor), and ZO1 (a mammalian tight junction protein). Two alternatively spliced transcript variants have been described for this gene which encode different protein isoforms and which are targeted differently in the Schwann cell. Mutations in this gene cause Charcot-Marie-Tooth neuoropathy, type 4F and Dejerine-Sottas neuropathy. [provided by RefSeq, Jul 2008]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Periaxin Antibody (NBP1-89598)(7)

Publications using NBP1-89598

• Kamp JC, Neubert L, Schupp JC et al. Multilamellated basement membranes in the capillary network of alveolar capillary dysplasia The American journal of pathology 2023-11-27 [PMID: 38029923]
• Han SH, Kim YH, Park SJ, Cho JG et Al. COUP-TFII plays a role in cAMP-induced Schwann cell differentiation and in vitro myelination by up-regulating Krox20 J Neurochem 2023-01-17 [PMID: 36648143]
• Shen M, Chen Z, Ming M, Cheng Z et Al. The acetylome of adult mouse sciatic nerve J Neurochem 2022-05-19 [PMID: 35585794]
• Sauler M, McDonough JE, Adams TS et al. Characterization of the COPD alveolar niche using single-cell RNA sequencing Nature Communications 2022-01-25 [PMID: 35078977] (Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Canine)
• Yuan Y, Leiby KL, Greaney AM et al. A Pulmonary Vascular Model From Endothelialized Whole Organ Scaffolds Frontiers in Bioengineering and Biotechnology 2021-11-19 [PMID: 34869270] (Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Canine)
• Koeppen AH, Becker AB, Qian J et al. Friedreich Ataxia: Developmental Failure of the Dorsal Root Entry Zone. J. Neuropathol. Exp. Neurol. 2017-11-01 [PMID: 29044418]
• Kegler K, Spitzbarth I, Imbschweiler I et al. Contribution of Schwann Cells to Remyelination in a Naturally Occurring Canine Model of CNS Neuroinflammation. PLoS One 2015-01-01 [PMID: 26196511] (IF/IHC, ICC/IF, Canine)

Review for Periaxin Antibody (NBP1-89598) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: Markus Tammia IHC-Fr Mouse 07/13/2015

Summary

• Application: Immunohistochemistry-Frozen
• Sample Tested: Mouse sciatic nerve
• Species: Mouse

FAQs for Periaxin Antibody (NBP1-89598). (Showing 1 - 1 of 1 FAQs).

1. Could you tell me if you expect the periaxin antibody NBP1-89598 to react with rat tissue?
   • This antibody has not been tested in rat. I performed a blast homology comparison to Rat with the immunogen and found only a 69% homology. However this has been validated in Mouse and Mouse only has a 72% homology and it seems to work fine. Mouse and rat are 92% homologous. The problem is that we cannot guarantee the antibody will work in rat but we can presume it will. This antibody was developed against Recombinant Protein corresponding to amino acids: MKVPDMKLPEIKLPKVPEMAVPDVHLPEVQLPKVSEIRLPEMQVPKVPDVHLPKAPEVKLPRAPEVQLKATKAEQAEGMEFGFKMPKMTMPKLGRAESPSRGKPGEAGAEVSGKLVTLPCLQPEVDGEAHVGVPSLTLPSVELDL

Bioinformatics

• Gene Symbol: PRX