Perforin Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related Perforin Peptides and Proteins

Order Details


    • Catalog Number
      NBP2-55214PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Perforin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Perforin.

Source: E. coli

Amino Acid Sequence: HQDQYSFSTDTVECRFYSFHVVHTPPLHPDFKRALGDLPHHFNASTQPAYLRLISNYGTHFIRAVELGGRISALTALRTCELALEGLTD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PRF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55214.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Perforin Recombinant Protein Antigen

  • Cytolysin
  • FLH2
  • HPLH2
  • HPLH2lymphocyte pore forming protein
  • Lymphocyte pore-forming protein
  • MGC65093
  • P1
  • P1PFN1
  • perforin 1 (pore forming protein)
  • Perforin
  • perforin-1
  • PFP
  • PFPcytolysin
  • PRF1

Background

Perforin (PRF1) is a 70 kD cytolytic protein that is the major protein constituent of cytoplasmic granules of cytotoxic T lymphocytes (CTLs) and natural killer (NK) cells. Specifically, perforin enters the target cell's plasma membrand and creates a intercellular pore to mediate targeted cell lysis. PRF1 antibodies are useful tools for lysis research on both CTLs and NK cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32870
Species: Ch, Hu
Applications: IHC,  IHC-P, IP, KD, WB
AF5866
Species: Hu
Applications: IHC, WB
NBP3-48674
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-84957
Species: Hu
Applications: IHC,  IHC-P, WB
H00000518-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-71702
Species: Ch, Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
H00201780-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB100-1607
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
NBP1-82859
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-85965
Species: Hu
Applications: IHC,  IHC-P
NBP1-84798
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-86784
Species: Hu
Applications: IHC,  IHC-P
NBP1-92355
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB600-326
Species: ET
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP2-38323
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-55214PEP
Species: Hu
Applications: AC

Publications for Perforin Recombinant Protein Antigen (NBP2-55214PEP) (0)

There are no publications for Perforin Recombinant Protein Antigen (NBP2-55214PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Perforin Recombinant Protein Antigen (NBP2-55214PEP) (0)

There are no reviews for Perforin Recombinant Protein Antigen (NBP2-55214PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Perforin Recombinant Protein Antigen (NBP2-55214PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Perforin Products

Research Areas for Perforin Recombinant Protein Antigen (NBP2-55214PEP)

Find related products by research area.

Blogs on Perforin.

You complete me: Natural killer cells need TGF-beta inhibition to effectively combat cancers
By Jamshed Arslan Pharm.D. Natural killer (NK) cells are lymphocytes of the innate immune system that were first discovered for their “natural” ability to kill cancer cells. To use NK cells as anti-cancer therapy, t...  Read full blog post.

Perforin a Protective Serial Killer
Secretory granule-mediated cell death is one of the the key mechanisms for elimination of virus-infected and transformed target cells by cytotoxic lymphocytes. Formation of the immunological synapse between an effector and a target cell leads to exocy...  Read full blog post.

Perforin Antibodies Reveal Links to Apoptosis and Immune Response
Perforin, also known as the pore-forming protein, pfp, is a 70 kD cytolytic protein expressed in the cytoplasmic granules of cytotoxic T lymphocytes (CTLs) and natural killer (NK) cells. It is one of the major effector molecules used by CTL and NK cel...  Read full blog post.

Perforin Antibodies for Detecting Immune System Diseases
 Perforin is a calcium-dependent pore forming cytolytic protein. Perforin is partially homologous to the terminal components of the membrane attack complex of complement and produces pores of up to 20nm in diameter on target membranes. Killer lymphocy...  Read full blog post.

Perforin Antibodies Reveal Links to Apoptosis and Immune Response
Perforin, also known as the pore-forming protein, pfp, is a 70 kD cytolytic protein expressed in the cytoplasmic granules of cytotoxic T lymphocytes (CTLs) and natural killer (NK) cells. It is one of the major effector molecules used by CTL and NK cel...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Perforin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PRF1