Recombinant Human Perforin GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human Perforin Protein [H00005551-Q01] - Partial recombinant protein with N-terminal GST tag on 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human Perforin GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 461-555 of Human Perforin

Source: Wheat Germ (in vitro)

Amino Acid Sequence: WSVRLDFGDVLLATGGPLRLQVWDQDSGRDDDLLGTCDQAPKSGSHEVRCNLNHGHLKFRYHARCLPHLGGGTCLDYVPQMLLGEPPGNRSGAVW

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
PRF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.19 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Perforin GST (N-Term) Protein

  • Cytolysin
  • FLH2
  • HPLH2
  • HPLH2lymphocyte pore forming protein
  • Lymphocyte pore-forming protein
  • MGC65093
  • P1
  • P1PFN1
  • perforin 1 (pore forming protein)
  • Perforin
  • perforin-1
  • PFP
  • PFPcytolysin
  • PRF1

Background

The protein encoded by this gene has structural and functional similarities to complement component 9 (C9). Like C9, this protein creates transmembrane tubules and is capable of lysing non-specifically a variety of target cells. This protein is one of the main cytolytic proteins of cytolytic granules, and it is known to be a key effector molecule for T-cell- and natural killer-cell-mediated cytolysis. Defects in this gene cause familial hemophagocytic lymphohistiocytosis type 2 (HPLH2), a rare and lethal autosomal recessive disorder of early childhood. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
AF5866
Species: Hu
Applications: IHC, WB
NBP2-15104
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84957
Species: Hu
Applications: IHC, IHC-P, WB
H00000518-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-71702
Species: Ch, Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
H00201780-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-1607
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
NBP1-82859
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85965
Species: Hu
Applications: IHC, IHC-P
NBP1-84798
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-59875
Species: Hu
Applications: WB
NBP3-35142
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NB600-326
Species: ET
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP2-38323
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
H00005551-Q01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for Perforin Partial Recombinant Protein (H00005551-Q01) (0)

There are no publications for Perforin Partial Recombinant Protein (H00005551-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Perforin Partial Recombinant Protein (H00005551-Q01) (0)

There are no reviews for Perforin Partial Recombinant Protein (H00005551-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Perforin Partial Recombinant Protein (H00005551-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Perforin Products

Research Areas for Perforin Partial Recombinant Protein (H00005551-Q01)

Find related products by research area.

Blogs on Perforin.

You complete me: Natural killer cells need TGF-beta inhibition to effectively combat cancers
By Jamshed Arslan Pharm.D. Natural killer (NK) cells are lymphocytes of the innate immune system that were first discovered for their “natural” ability to kill cancer cells. To use NK cells as anti-cancer therapy, t...  Read full blog post.

Perforin a Protective Serial Killer
Secretory granule-mediated cell death is one of the the key mechanisms for elimination of virus-infected and transformed target cells by cytotoxic lymphocytes. Formation of the immunological synapse between an effector and a target cell leads to exocy...  Read full blog post.

Perforin Antibodies Reveal Links to Apoptosis and Immune Response
Perforin, also known as the pore-forming protein, pfp, is a 70 kD cytolytic protein expressed in the cytoplasmic granules of cytotoxic T lymphocytes (CTLs) and natural killer (NK) cells. It is one of the major effector molecules used by CTL and NK cel...  Read full blog post.

Perforin Antibodies for Detecting Immune System Diseases
 Perforin is a calcium-dependent pore forming cytolytic protein. Perforin is partially homologous to the terminal components of the membrane attack complex of complement and produces pores of up to 20nm in diameter on target membranes. Killer lymphocy...  Read full blog post.

Perforin Antibodies Reveal Links to Apoptosis and Immune Response
Perforin, also known as the pore-forming protein, pfp, is a 70 kD cytolytic protein expressed in the cytoplasmic granules of cytotoxic T lymphocytes (CTLs) and natural killer (NK) cells. It is one of the major effector molecules used by CTL and NK cel...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Perforin GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PRF1