Perforin Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Perforin Antibody [NBP2-55214] - Staining of human cell line Hep G2 shows localization to cytosol. Antibody staining is shown in green.

Product Details

Summary
Product Discontinued
View other related Perforin Primary Antibodies

Order Details


    • Catalog Number
      NBP2-55214
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Perforin Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HQDQYSFSTDTVECRFYSFHVVHTPPLHPDFKRALGDLPHHFNASTQPAYLRLISNYGTHFIRAVELGGRISALTALRTCELALEGLTD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRF1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Perforin Antibody

  • Cytolysin
  • FLH2
  • HPLH2
  • HPLH2lymphocyte pore forming protein
  • Lymphocyte pore-forming protein
  • MGC65093
  • P1
  • P1PFN1
  • perforin 1 (pore forming protein)
  • Perforin
  • perforin-1
  • PFP
  • PFPcytolysin
  • PRF1

Background

Perforin (PRF1) is a 70 kD cytolytic protein that is the major protein constituent of cytoplasmic granules of cytotoxic T lymphocytes (CTLs) and natural killer (NK) cells. Specifically, perforin enters the target cell's plasma membrand and creates a intercellular pore to mediate targeted cell lysis. PRF1 antibodies are useful tools for lysis research on both CTLs and NK cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32870
Species: Ch, Hu
Applications: IHC,  IHC-P, IP, KD, WB
AF5866
Species: Hu
Applications: IHC, WB
NBP3-48674
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-84957
Species: Hu
Applications: IHC,  IHC-P, WB
H00000518-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-71702
Species: Ch, Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
H00201780-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB100-1607
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
NBP1-82859
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-85965
Species: Hu
Applications: IHC,  IHC-P
NBP1-84798
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-86784
Species: Hu
Applications: IHC,  IHC-P
NBP1-92355
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB600-326
Species: ET
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP2-38323
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-55214
Species: Hu
Applications: ICC/IF

Publications for Perforin Antibody (NBP2-55214) (0)

There are no publications for Perforin Antibody (NBP2-55214).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Perforin Antibody (NBP2-55214) (0)

There are no reviews for Perforin Antibody (NBP2-55214). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Perforin Antibody (NBP2-55214) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Perforin Products

Research Areas for Perforin Antibody (NBP2-55214)

Find related products by research area.

Blogs on Perforin.

You complete me: Natural killer cells need TGF-beta inhibition to effectively combat cancers
By Jamshed Arslan Pharm.D. Natural killer (NK) cells are lymphocytes of the innate immune system that were first discovered for their “natural” ability to kill cancer cells. To use NK cells as anti-cancer therapy, t...  Read full blog post.

Perforin a Protective Serial Killer
Secretory granule-mediated cell death is one of the the key mechanisms for elimination of virus-infected and transformed target cells by cytotoxic lymphocytes. Formation of the immunological synapse between an effector and a target cell leads to exocy...  Read full blog post.

Perforin Antibodies Reveal Links to Apoptosis and Immune Response
Perforin, also known as the pore-forming protein, pfp, is a 70 kD cytolytic protein expressed in the cytoplasmic granules of cytotoxic T lymphocytes (CTLs) and natural killer (NK) cells. It is one of the major effector molecules used by CTL and NK cel...  Read full blog post.

Perforin Antibodies for Detecting Immune System Diseases
 Perforin is a calcium-dependent pore forming cytolytic protein. Perforin is partially homologous to the terminal components of the membrane attack complex of complement and produces pores of up to 20nm in diameter on target membranes. Killer lymphocy...  Read full blog post.

Perforin Antibodies Reveal Links to Apoptosis and Immune Response
Perforin, also known as the pore-forming protein, pfp, is a 70 kD cytolytic protein expressed in the cytoplasmic granules of cytotoxic T lymphocytes (CTLs) and natural killer (NK) cells. It is one of the major effector molecules used by CTL and NK cel...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Perforin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRF1