Pentraxin 4 Antibody

Images

 
Immunohistochemistry: Pentraxin 4 Antibody [NBP2-68966] - Staining of human lymph node shows strong cytoplamic positivity in non-germinal center cells and distinct plasma staining.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Pentraxin 4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GGFDSSEAFVGSMSGLAIWDRALVPGEVANLAIGKEFPTGAILTLANAALAGGFVQGANCTCLERC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTX4
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
Recommended conditions for IHC,Retrieval method: HIER pH6

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for Pentraxin 4 Antibody

  • C16orf38
  • Chromosome 16 Open Reading Frame 38
  • Long Pentraxin 4
  • Neuronal Pentraxin-Like Protein C16orf38
  • Pentraxin 4, Long
  • Pentraxin-4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2558
Species: Hu, Mu
Applications: WB, Simple Western
NBP1-92274
Species: Hu
Applications: WB, IHC, IHC-P
H00005308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-81626
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-25160
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq
Applications: WB, ICC/IF, IHC
NBP2-56121
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB4850
Species: Hu
Applications: WB, Simple Western
NBP1-88644
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82985
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB500-330
Species: Hu
Applications: Flow, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready

Publications for Pentraxin 4 Antibody (NBP2-68966) (0)

There are no publications for Pentraxin 4 Antibody (NBP2-68966).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pentraxin 4 Antibody (NBP2-68966) (0)

There are no reviews for Pentraxin 4 Antibody (NBP2-68966). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Pentraxin 4 Antibody (NBP2-68966) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Pentraxin 4 Products

Bioinformatics Tool for Pentraxin 4 Antibody (NBP2-68966)

Discover related pathways, diseases and genes to Pentraxin 4 Antibody (NBP2-68966). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for Pentraxin 4 Antibody (NBP2-68966)

View related products by pathway.

Blogs on Pentraxin 4

There are no specific blogs for Pentraxin 4, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pentraxin 4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTX4
Novus 100% Guarantee