Recombinant Human PELO Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PELO Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-385 of Human PELO full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MKLVRKNIEKDNAGQVTLVPEEPEDMWHTYNLVQVGDSLRASTIRKVQTESSTGSVGSNRVRTTLTLCVEAIDFDSQACQLRVKGTNIQENEYVKMGAYHTIELEPNRQFTLAKKQWDSVVLERIEQACDPAWSADVAAVVMQEGLAHICLVTPSMTLTRAKVEVNIPRKRKGNCSQHDRALERFYEQVVQAIQRHIHFDVVKCILVASPGFVREQFCDYMFQQAVKTDNKLLLENRSKFLQVHASSGHKYSLKEALCDPTVASRLSDTKAAGEVKALDDFYKMLQHEPDRAFYGLKQVEKANEAMAIDTLLISDELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLHVSGEQLSQLTGVAAILRFPVPELSDQEGDSSSEED

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
PELO
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PELO Protein

  • EC 3.1
  • pelota (Drosophila) homolog
  • pelota homolog (Drosophila)
  • PRO1770
  • protein pelota homolog

Background

This gene encodes a protein which contains a conserved nuclear localization signal. The encoded protein may have a role in spermatogenesis, cell cycle control, and in meiotic cell division. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1233
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
NBP1-02902
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-33063
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-24524
Species: Hu, Mu, Rt, Bv, Ca, Eq, Pm
Applications: WB, IHC-P
AF5458
Species: Hu
Applications: WB, ICC
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP1-77086
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-53088
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57200
Species: Hu
Applications: ICC/IF
H00053918-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for PELO Recombinant Protein (H00053918-P01) (0)

There are no publications for PELO Recombinant Protein (H00053918-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PELO Recombinant Protein (H00053918-P01) (0)

There are no reviews for PELO Recombinant Protein (H00053918-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PELO Recombinant Protein (H00053918-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PELO Products

Bioinformatics Tool for PELO Recombinant Protein (H00053918-P01)

Discover related pathways, diseases and genes to PELO Recombinant Protein (H00053918-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PELO Recombinant Protein (H00053918-P01)

Discover more about diseases related to PELO Recombinant Protein (H00053918-P01).
 

Pathways for PELO Recombinant Protein (H00053918-P01)

View related products by pathway.

PTMs for PELO Recombinant Protein (H00053918-P01)

Learn more about PTMs related to PELO Recombinant Protein (H00053918-P01).

Blogs on PELO

There are no specific blogs for PELO, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PELO Antibody
NBP2-19769
Thrombopoietin/Tpo
288-TP-005/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PELO Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PELO