PEG3 Antibody

Images

 
Western Blot: PEG3 Antibody [NBP2-47624] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human cell line HepG2.
Immunocytochemistry/ Immunofluorescence: PEG3 Antibody [NBP2-47624] - Staining human cell line Hep G2 shows positivity in nucleus but excluded from the nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PEG3 Antibody [NBP2-47624] - Staining of human placenta shows strong nuclear positivity in trophoblastic in trophoblastic cells and decidua cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PEG3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SSNVREYQKARAKKKYIEHRSNETSVIHSLPFGEQTFRPRGMLYECQECGECFAHSSDLTEHQKIHDREKPSGSRNYEWSVIRSLAPTDPQTSYAQEQYAKEQARNKCKDFRQFFATSEDLNTNQKIYDQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PEG3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PEG3 Recombinant Protein Antigen (NBP2-47624PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PEG3 Antibody

  • DKFZp781A095
  • KIAA0287PW1
  • paternally expressed 3
  • paternally expressed gene 3
  • Zinc finger and SCAN domain-containing protein 24
  • ZNF904
  • ZSCAN24Kruppel-type zinc finger protein

Background

In human, ZIM2 and PEG3 are treated as two distinct genes though they share multiple 5' exons and a common promoter and both genes are paternally expressed (PMID:15203203). Alternative splicing events connect their shared 5' exons either with the remaining 4 exons unique to ZIM2, or with the remaining 2 exons unique to PEG3. In contrast, in other mammals ZIM2 does not undergo imprinting and, in mouse, cow, and likely other mammals as well, the ZIM2 and PEG3 genes do not share exons. Human PEG3 protein belongs to the Kruppel C2H2-type zinc finger protein family. PEG3 may play a role in cell proliferation and p53-mediated apoptosis. PEG3 has also shown tumor suppressor activity and tumorigenesis in glioma and ovarian cells. Alternative splicing of this PEG3 gene results in multiple transcript variants encoding distinct isoforms. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87299
Species: Hu
Applications: ICC/IF, WB
NBP2-20439
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
292-G2
Species: Hu
Applications: BA
NB300-514
Species: Bv, Hu, Mu, Pm, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
210-TA
Species: Hu
Applications: BA
NB100-88153
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
NBP1-89917
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-52477
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
NBP2-37343
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-20932
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-86989
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP1-28875
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
MAB1144
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
H00004826-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-47624
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PEG3 Antibody (NBP2-47624) (0)

There are no publications for PEG3 Antibody (NBP2-47624).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PEG3 Antibody (NBP2-47624) (0)

There are no reviews for PEG3 Antibody (NBP2-47624). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PEG3 Antibody (NBP2-47624) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PEG3 Products

Bioinformatics Tool for PEG3 Antibody (NBP2-47624)

Discover related pathways, diseases and genes to PEG3 Antibody (NBP2-47624). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PEG3 Antibody (NBP2-47624)

Discover more about diseases related to PEG3 Antibody (NBP2-47624).
 

Pathways for PEG3 Antibody (NBP2-47624)

View related products by pathway.

PTMs for PEG3 Antibody (NBP2-47624)

Learn more about PTMs related to PEG3 Antibody (NBP2-47624).
 

Research Areas for PEG3 Antibody (NBP2-47624)

Find related products by research area.

Blogs on PEG3

There are no specific blogs for PEG3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PEG3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PEG3
Entrez
Uniprot