PECR Antibody

Images

 
Western Blot: PECR Antibody [NBP1-83198] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: PECR Antibody [NBP1-83198] - Staining of human cell line A-431 shows localization to peroxisomes.
Immunohistochemistry-Paraffin: PECR Antibody [NBP1-83198] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PECR Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IRINCVAPGVIYSQTAVENYGSWGQSFFEGSFQKIPAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGGRSLYTHSYEVPDHDNWPKGAGDLSVVKKMKETFKEKAKL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PECR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PECR Protein (NBP1-83198PEP)
Publications
Read Publication using NBP1-83198.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PECR Antibody

  • DCR-RP
  • EC 1.3.1.38
  • HPDHASE
  • HSA250303
  • peroxisomal trans-2-enoyl-CoA reductase
  • putative short chain alcohol dehydrogenase
  • pVI-ARL
  • PVIARL2,4-dienoyl-CoA reductase-related protein
  • SDR29C1
  • short chain dehydrogenase/reductase family 29C, member 1
  • TERPDCRRP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-305
Species: Hu, Mu, Mk
Applications: WB, ChIP, DB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-33463
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-92273
Species: Hu
Applications: IHC, IHC-P
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
27570002
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-47405
Species: Hu
Applications: IHC, IHC-P
NBP2-57496
Species: Hu
Applications: ICC/IF
NBP2-49156
Species: Hu
Applications: ICC/IF, IHC
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-80775
Species: Hu
Applications: IHC, IHC-P

Publications for PECR Antibody (NBP1-83198)(1)

Reviews for PECR Antibody (NBP1-83198) (0)

There are no reviews for PECR Antibody (NBP1-83198). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PECR Antibody (NBP1-83198) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PECR Products

Bioinformatics Tool for PECR Antibody (NBP1-83198)

Discover related pathways, diseases and genes to PECR Antibody (NBP1-83198). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PECR Antibody (NBP1-83198)

Discover more about diseases related to PECR Antibody (NBP1-83198).

Research Areas for PECR Antibody (NBP1-83198)

Find related products by research area.

Blogs on PECR

There are no specific blogs for PECR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PECR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PECR