Recombinant Human PDK4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PDK4 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 181 - 280 of Human PDK4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SDSQTGNPSHIGSIDPNCDVVAVVQDAFGCSRMLCDQYYLSSPELKLTQANGKFPDQPIHIVYVPSHLHHMLFELFKNAMRATVEHQENQPSLTPIEVIV

Protein/Peptide Type
Partial Recombinant Protein
Gene
PDK4

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PDK4 Protein

  • [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 4, mitochondrial
  • EC 2.7.11
  • EC 2.7.11.2
  • FLJ40832
  • Pyruvate dehydrogenase kinase isoform 4
  • pyruvate dehydrogenase kinase, isoenzyme 4
  • pyruvate dehydrogenase kinase, isozyme 4
  • pyruvate dehydrogenase, lipoamide, kinase isozyme 4, mitochondrial

Background

PDK4 - pyruvate dehydrogenase kinase, isoenzyme 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-87307
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88347
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56992
Species: Hu
Applications: IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-82432
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-04676
Species: Hu, Mu, Rt, Ha, Sq
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-24608
Species: Hu, Mu, Rt, Pm
Applications: WB
NBP2-31376
Species: Hu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-2383
Species: Hu
Applications: WB, ICC/IF
NB100-53791
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
MAB864
Species: Hu, Mu, Rt
Applications: WB, ICC
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NB100-2564
Species: Hu
Applications: WB
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-637
Species: Hu, Mu, Rt, Ge
Applications: WB, ELISA, IHC, IHC-P

Publications for PDK4 Partial Recombinant Protein (H00005166-Q01) (0)

There are no publications for PDK4 Partial Recombinant Protein (H00005166-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDK4 Partial Recombinant Protein (H00005166-Q01) (0)

There are no reviews for PDK4 Partial Recombinant Protein (H00005166-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PDK4 Partial Recombinant Protein (H00005166-Q01). (Showing 1 - 1 of 1 FAQ).

  1. Which PDK4 antibody do you recommend for immunoblot? I'm working with human cell lines.
    • NBP1-07047 and NBP1-07049 are our best selling PDK4 antibodies that will meet your mentioned criteria i.e. Immunoblot/Western Blot in Human samples. However, all of our products are 100% guaranteed and you may find a complete list of PDK4 antibodies by searching PDK4 on our website and narrowing your results using the filters on the left-hand side of the screen.

Additional PDK4 Products

Bioinformatics Tool for PDK4 Partial Recombinant Protein (H00005166-Q01)

Discover related pathways, diseases and genes to PDK4 Partial Recombinant Protein (H00005166-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDK4 Partial Recombinant Protein (H00005166-Q01)

Discover more about diseases related to PDK4 Partial Recombinant Protein (H00005166-Q01).
 

Pathways for PDK4 Partial Recombinant Protein (H00005166-Q01)

View related products by pathway.

PTMs for PDK4 Partial Recombinant Protein (H00005166-Q01)

Learn more about PTMs related to PDK4 Partial Recombinant Protein (H00005166-Q01).
 

Research Areas for PDK4 Partial Recombinant Protein (H00005166-Q01)

Find related products by research area.

Blogs on PDK4

There are no specific blogs for PDK4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PDK4 Blocking Peptide
NBP1-07049PEP
PDK4 Antibody
NBP1-07047

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PDK4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PDK4