PDK2 Antibody (2G1) - Azide and BSA Free

Western Blot: PDK2 Antibody (2G1) [H00005164-M01] - Analysis of PDK2 expression in transfected 293T cell line by PDK2 monoclonal antibody (M01), clone 2G1.Lane 1: PDK2 transfected lysate(46.2 KDa).Lane 2: Non-transfected lysate.

Immunohistochemistry-Paraffin: PDK2 Antibody (2G1) [H00005164-M01] - Analysis of monoclonal antibody to PDK2 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 0.8 ug/ml.

Western Blot: PDK2 Antibody (2G1) [H00005164-M01] - Analysis of PDK2 over-expressed 293 cell line, cotransfected with PDK2 Validated Chimera RNAi ( Cat # H00005164-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PDK2 monoclonal antibody (M01) clone 2G1 (Cat # H00005164-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

Western Blot: PDK2 Antibody (2G1) [H00005164-M01] - PDK2 monoclonal antibody (M01), clone 2G1 Analysis of PDK2 expression in U-2 OS.

Sandwich ELISA: PDK2 Antibody (2G1) [H00005164-M01] - Detection limit for recombinant GST tagged PDK2 is approximately 0.3ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IHC, KD
• Clone: 2G1
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PDK2 Antibody (2G1) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: PDK2 (AAH05811, 187 a.a. ~ 276 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEINAANSKQPIHMVYVPSHLYHMLFELFKNAMRATVESHESSLILPPIKVM
• Specificity: PDK2 - pyruvate dehydrogenase kinase, isoenzyme 2
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PDK2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 0.8ug/ml
  • Knockdown Validated
  • Sandwich ELISA 1:100-1:2000
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P, RNAi Validation and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PDK2 Antibody (2G1) - Azide and BSA Free

• EC 2.7.11
• EC 2.7.11.2
• lipoamide, kinase isozyme 2, mitochondrial
• PDH kinase 2
• PDHK2
• PDK2
• PDKII
• Pyruvate dehydrogenase kinase isoform 2
• pyruvate dehydrogenase kinase, isoenzyme 2
• pyruvate dehydrogenase kinase, isozyme 2

Background

PDK2 inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PDK2
• Entrez:
  • 5164(Human)
• OMIM:
  • 602525(Human)
• Uniprot:
  • AAH05811(Human)