PDILT Antibody - BSA Free

Western Blot: PDILT Antibody [NBP1-80933] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: PDILT Antibody [NBP1-80933] - Staining of human testis shows moderate cytoplasmic positivity in subset of cells in seminiferus ducts and additional nuclear staining in Leydig cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PDILT Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VSSIHITKPVHILEERSLLVLTPAGLTQMLNQTRFLMVLFHNPSSKQSRNLAEELGKAVEIMGKGKNGIGFGKVDITIEKELQQEFGI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PDILT
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PDILT Protein (NBP1-80933PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PDILT Antibody - BSA Free

• PDIA7
• protein disulfide isomerase family A, member 7
• protein disulfide isomerase-like protein of the testis
• protein disulfide isomerase-like, testis expressed
• protein disulfide-isomerase-like protein of the testis

Background

Probable redox-inactive chaperone involved in spermatogenesis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PDILT
• Entrez:
  • 204474(Human)