Calreticulin-2/CALR3 Antibody - BSA Free

Immunohistochemistry-Paraffin: Calreticulin-2/CALR3 Antibody [NBP2-33524] - Staining in human testis and endometrium tissues using anti-CALR3 antibody. Corresponding CALR3 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Calreticulin-2/CALR3 Antibody [NBP2-33524] - Staining of human colon, kidney, liver and testis using Anti-CALR3 antibody NBP2-33524 (A) shows similar protein distribution across tissues to independent antibody NBP2-33390 (B).

Immunohistochemistry-Paraffin: Calreticulin-2/CALR3 Antibody [NBP2-33524] - Immunohistochemical staining of CT antigens in normal tissues. Among 22 normal tissues (see materials and methods), ADAM2, CALR3 (shown in image), SAGE1 and MAGE-A proteins were only detected in the germ cells of the testis. More specifically, SAGE-1 and MAGE-A were found in spermatogonia, while ADAM2 and CALR3 were present in post-meiotic germ cells. Only MAGE-A proteins were detected in placenta (all pictures magnification x20). Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0134967), licensed under a CC-BY license.

Western Blot: Calreticulin-2/CALR3 Antibody [NBP2-33524] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4

Immunohistochemistry-Paraffin: Calreticulin-2/CALR3 Antibody [NBP2-33524] - Staining of human colon.

Immunohistochemistry-Paraffin: Calreticulin-2/CALR3 Antibody [NBP2-33524] - Staining of human endometrium shows low expression as expected.

Immunohistochemistry-Paraffin: Calreticulin-2/CALR3 Antibody [NBP2-33524] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: Calreticulin-2/CALR3 Antibody [NBP2-33524] - Staining of human kidney.

Immunohistochemistry-Paraffin: Calreticulin-2/CALR3 Antibody [NBP2-33524] - Staining of human liver.

Immunohistochemistry: Calreticulin-2/CALR3 Antibody [NBP2-33524] - Immunohistochemical staining of CT antigens in lung & breast cancer tumors.Examples of lung & breast cancer tumors positive for MAGE-A & negative for ADAM2, CALR3 & SAGE1 (all pictures magnification x20). Image collected & cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0134967), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Immunohistochemistry: Calreticulin-2/CALR3 Antibody [NBP2-33524] - Immunohistochemical staining of CT antigens in normal tissues.Among 22 normal tissues (see materials & methods), ADAM2, CALR3, SAGE1 & MAGE-A proteins were only detected in the germ cells of the testis. More specifically, SAGE-1 & MAGE-A were found in spermatogonia, while ADAM2 & CALR3 were present in post-meiotic germ cells. Only MAGE-A proteins were detected in plancenta (all pictures magnification x20). Image collected & cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0134967), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Calreticulin-2/CALR3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Calreticulin-2/CALR3 Antibody - BSA Free (NBP2-33524) is a polyclonal antibody validated for use in IHC and WB. Anti-Calreticulin-2/CALR3 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SIEYDWNLTSLKKETSPAESKDWEQTKDNKAQDWEKHFLDASTSKQSDWNGDLDGDWPAPMLQKPPYQDGLKPEGIHKGVWLHRKMKNTDYLTQYDLSEF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CALR3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Calreticulin-2/CALR3 Recombinant Protein Antigen (NBP2-33524PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Calreticulin-2/CALR3 Antibody - BSA Free

• CALR3
• calreticulin 2
• calreticulin 3
• Calreticulin2
• Calreticulin-2
• calreticulin-3
• cancer/testis antigen 93
• Crt2
• CRT2calreticulin-2
• CT93
• FLJ25355
• MGC26577

Background

Calreticulins, such as CALR3, are Ca(2+)-binding chaperones localized mainly in the endoplasmic/sarcoplasmic reticulum Persson et al. (2002) [PubMed 12384296].[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Calreticulin-2/CALR3 Antibody (NBP2-33524)(2)

Publications using NBP2-33524

• Verhagen J. M. A, Veldman J. H, et al. Lack of evidence for a causal role of CALR3 in monogenic cardiomyopathy. Eur J Hum Genet 2018-11-01 [PMID: 29988065] (Immunohistochemistry-Paraffin, Human)
• Maheswaran E, Pedersen CB, Ditzel HJ, Gjerstorff MF. Lack of ADAM2, CALR3 and SAGE1 Cancer/Testis Antigen Expression in Lung and Breast Cancer. PLoS One 2015-01-01 [PMID: 26252478] (IHC-P, Human)

Bioinformatics

• Gene Symbol: CALR3
• Uniprot:
  • Q96L12()