PDHA2 Antibody

Images

 
Western Blot: PDHA2 Antibody [H00005161-D01P] - Analysis of PDHA2 expression in mouse testis.
Immunocytochemistry/ Immunofluorescence: PDHA2 Antibody [H00005161-D01P] - Analysis of antibody to PDHA2 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: PDHA2 Antibody [H00005161-D01P] - Analysis of PDHA2 expression in A-431.
Western Blot: PDHA2 Antibody [H00005161-D01P] - Analysis of PDHA2 expression in transfected 293T cell line by PDHA2 polyclonal antibody.Lane 1: PDHA2 transfected lysate(42.90 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PDHA2 Antibody Summary

Immunogen
PDHA2 (NP_005381.1, 1 a.a. - 388 a.a.) full-length human protein. MLAAFISRVLRRVAQKSARRVLVASRNSSNDATFEIKKCDLYLLEEGPPVTTVLTRAEGLKYYRMMLTVRRMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHGVCYTRGLSVRSILAELTGRRGGCAKGKGGSMHMYTKNFYGGNGIVGAQGPLGAGIALACKYKGNDEICLTLYGDGAANQGQIAEAFNMAALWKLPCVFICENNLYGMGTSTERAAASPDYYKRGNFIPGLKVDGMDVLCVREATKFAANYCRSGKGPILMELQTYRYHGHSMSDPGVSYRTREEIQEVRSKRDPIIILQDRMVNSKLATVEELKEIGAEVRKEIDDAAQFATTDPEPHLEELGHHIYSSDSSFEVRGANPWIKFKSVS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDHA2
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PDHA2 Antibody

  • EC 1.2.4.1
  • MGC149517
  • MGC149518
  • mitochondrial
  • PDHAL
  • PDHE1-A type II
  • pyruvate dehydrogenase (lipoamide) alpha 2
  • pyruvate dehydrogenase E1 component subunit alpha, testis-specific form
  • pyruvate dehydrogenase, E1-alpha polypeptide, testis specific

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-93479
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NBP2-24493
Species: Hu, Mu, Bv, Ch, Eq, Op, Pm
Applications: WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31452
Species: Hu
Applications: WB, IHC, IHC-P
AF2000
Species: Hu
Applications: WB, Simple Western, Flow, CyTOF-ready
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NBP1-90171
Species: Hu
Applications: IHC, IHC-P
AF1005
Species: Hu
Applications: WB, IHC
NBL1-11228
Species: Hu
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92065
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005018-D01P
Species: Hu
Applications: WB, ICC/IF
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
H00000013-M01
Species: Hu
Applications: WB, ELISA
NBP1-81763
Species: Hu
Applications: IHC, IHC-P

Publications for PDHA2 Antibody (H00005161-D01P) (0)

There are no publications for PDHA2 Antibody (H00005161-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDHA2 Antibody (H00005161-D01P) (0)

There are no reviews for PDHA2 Antibody (H00005161-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PDHA2 Antibody (H00005161-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PDHA2 Products

Bioinformatics Tool for PDHA2 Antibody (H00005161-D01P)

Discover related pathways, diseases and genes to PDHA2 Antibody (H00005161-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDHA2 Antibody (H00005161-D01P)

Discover more about diseases related to PDHA2 Antibody (H00005161-D01P).
 

Pathways for PDHA2 Antibody (H00005161-D01P)

View related products by pathway.

PTMs for PDHA2 Antibody (H00005161-D01P)

Learn more about PTMs related to PDHA2 Antibody (H00005161-D01P).

Blogs on PDHA2

There are no specific blogs for PDHA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDHA2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDHA2
Uniprot