PDE8A Antibody - BSA Free

Western Blot: PDE8A Antibody [NBP3-35230] - Western blot analysis of various lysates using PDE8A Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.

• Reactivity: Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PDE8A Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human PDE8A (NP_002596.1).
  
  Sequence:
  MGCAPSIHISERLVAEDAPSPAAPPLSSGGPRLPQGQKTAALPRTRGAGLLESELRDGSGKKVAVADVQFGPMRFHQDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PDE8A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 93 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for PDE8A Antibody - BSA Free

• cAMP-specific cyclic nucleotide phosphodiesterase 8A
• EC 3.1.4.17
• FLJ16150
• high affinity cAMP-specific and IBMX-insensitive 3'-5'-cyclic phosphodiesterase8A
• high-affinity cAMP-specific and IBMX-insensitive 3'-5'-cyclic phosphodiesterase8A
• HsT19550
• PDE8A
• phosphodiesterase 8A

Background

Phosphodiesterase type 8 (PDE8) is one of the many phosphodiesterases that compartmentalize and hydrolyze cAMP into AMP. The cAMP-specific PDE8 family is comprised of 2 genes (PDE8A and PDE8B) each with multiple splice variants generated by RNA splicing and use of alternate initiation sites. PDE8 family is a high affinity cAMP-specific, IBMX sensitive PDE. PDE8 has a significant conserved region of about 270 amino acids common to all PDEs at the carboxy terminal apparently serves as the catalytic domain. The amino-terminal region of this protein is divergent and presumably accounts for the distinctive and regulatory properties unique to the individual PDE families. PDE8A protein showed significant homology to other cAMP-dependent PDEs (23%) within the catalytic domain. PDE8A is widely expressed in various tissues in contrast to PDE8B that is exclusively expressed in thyroid gland. The PDE8A transcripts are found in brain, pancreas, placenta, thyroid, spleen, trachea, prostate, and uterus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PDE8A