PDE8A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PDE8A Antibody [NBP1-83160] - Immunofluorescent staining of human cell line U-2 OS shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: PDE8A Antibody [NBP1-83160] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PDE8A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TTMGYQSGELIGKELGEVPINEKKADLLDTINSCIRIGKEWQGIYYAKKKNGDNIQQNVKIIPVIGQGGKIRHYVSIIRVCNGNNKAEKISECVQSDTHTDNQTGKHKDRRKGSLDVKAVASRATEVSSQRRHSS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDE8A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PDE8A Protein (NBP1-83160PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PDE8A Antibody

  • cAMP-specific cyclic nucleotide phosphodiesterase 8A
  • EC 3.1.4.17
  • FLJ16150
  • high affinity cAMP-specific and IBMX-insensitive 3'-5'-cyclic phosphodiesterase8A
  • high-affinity cAMP-specific and IBMX-insensitive 3'-5'-cyclic phosphodiesterase8A
  • HsT19550
  • phosphodiesterase 8A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15343
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02559
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86280
Species: Hu
Applications: IHC, IHC-P
NBP1-83275
Species: Hu
Applications: IHC, IHC-P
NBP1-85645
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-46183
Species: Hu
Applications: WB, IP
NB100-2462
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, PEP-ELISA
NBP2-01171
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86139
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-645
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-00641
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-46355
Species: Hu
Applications: WB, IHC
NB300-672
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-03598
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-325
Species: Hu
Applications: WB, ChIP, IP
NBP2-13541
Species: Hu, Mu
Applications: Simple Western, IHC, IHC-P
NBP1-32341
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83160
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for PDE8A Antibody (NBP1-83160) (0)

There are no publications for PDE8A Antibody (NBP1-83160).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDE8A Antibody (NBP1-83160) (0)

There are no reviews for PDE8A Antibody (NBP1-83160). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PDE8A Antibody (NBP1-83160) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PDE8A Products

Bioinformatics Tool for PDE8A Antibody (NBP1-83160)

Discover related pathways, diseases and genes to PDE8A Antibody (NBP1-83160). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDE8A Antibody (NBP1-83160)

Discover more about diseases related to PDE8A Antibody (NBP1-83160).
 

Pathways for PDE8A Antibody (NBP1-83160)

View related products by pathway.

PTMs for PDE8A Antibody (NBP1-83160)

Learn more about PTMs related to PDE8A Antibody (NBP1-83160).
 

Research Areas for PDE8A Antibody (NBP1-83160)

Find related products by research area.

Blogs on PDE8A

There are no specific blogs for PDE8A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDE8A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDE8A