PDE7A Antibody - Azide and BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 345-456 of human PDE7A (NP_002594.1). ELSKQWSEKVTEEFFHQGDIEKKYHLGVSPLCDRHTESIANIQIGFMTYLVEPLFTEWARFSNTRLSQTMLGHVGLNKASWKGLQREQSSSEDTDAAFELNSQLLPQENRLS |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PDE7A |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500-1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for PDE7A Antibody - Azide and BSA Free
Background
The cyclic monophosphate nucleotides (cyclic adenosine monophosphate [cAMP] and cyclic guanosine monophosphate [cGMP]) are found ubiquitously in mammalian cells and act as second messenger transducers to effect the intracellular actions of a variety of G protein coupled receptors (GPCRs) for hormones, cytokines, and neurotransmitters. Cyclic nucleotides are important intracellular second messengers which play important role in a variety of signal transduction process. The cyclic nucleotides are hydrolyzed and compartmentalized by a family of enzymes called phosphodieterases. One of the many phosphodiesterases that compartmentalized and hydrolyze cAMP in T Lymphocytes are phosphodiesterase type 7. The cAMP specific phosphodiesterase type 7 (PDE7) family is comprised of 2 genes (PDE7A and PDE7B) each with multiple splice variants generated by RNA splicing and use of alternate initiation sites. PDE7A has two splice variants (PDE7A1 and PDE7A2). The two are divergent at the 5 prime end in human, and PDE7A1 is more hydrophobic. Like other PDEs, human PDE7A gene has 456 amino acids and migrates at an apparent molecular weight of 53 to 55 kDa on reduced SDS PAGE. The PDE7A has a significant conserved region of about 270 amino acids common to all PDEs at the carboxy terminal apparently serves as the catalytic domain. The amino terminal region of this protein is divergent and presumably accounts for the distinctive and regulatory properties unique to the individual PDE families. PDE7A protein showed significant homology to other cAMP dependent PDEs (23%) with in the catalytic domain. PDE7A is widely expressed in various tissues including skeletal muscle, T lymphocytes, brain and pancreas.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Ch, Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Bv, Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: DirELISA, IP, WB
Species: Mu
Applications: ELISA
Species: Mu
Applications: CompCytotox, CyTOF-ready, Flow, ICC, IHC, IP, Tstim
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for PDE7A Antibody (NBP2-95163) (0)
There are no publications for PDE7A Antibody (NBP2-95163).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PDE7A Antibody (NBP2-95163) (0)
There are no reviews for PDE7A Antibody (NBP2-95163).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PDE7A Antibody (NBP2-95163) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PDE7A Products
Research Areas for PDE7A Antibody (NBP2-95163)
Find related products by research area.
|
Blogs on PDE7A