PDE6H Antibody - BSA Free

Immunohistochemistry-Paraffin: PDE6H Antibody [NBP2-68659] - Staining of human eye, retina shows strong cytoplasmic positivity in photoreceptor cells.

Immunohistochemistry-Paraffin: PDE6H Antibody [NBP2-68659] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: PDE6H Antibody [NBP2-68659] - Staining of human kidney shows no positivity in cells in tubules and cells in glomeruli as expected.

Immunohistochemistry-Paraffin: PDE6H Antibody [NBP2-68659] - Staining of human tonsil shows no positivity in non-germinal center cells and germinal center cells as expected.

• Reactivity: Hu, Pm, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PDE6H Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PRKGPPKFKQRQTRQFKSKPPKKGVKGFGDDIPGMEGLGTDITVICPWEAFSHLELHELA
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PDE6H
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Frozen Reported in scientific literature (PMID:35024589)
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
• Application Notes: Recommended conditions for IHC,Retrieval method: HIER pH6.
• Control Peptide:

  PDE6H Recombinant Protein Antigen (NBP2-68659PEP)

Reactivity Notes

Use in Monkey reported in scientific literature (PMID:35024589) .

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for PDE6H Antibody - BSA Free

• EC 3.1.4.17
• EC 3.1.4.35
• GMP-PDE gamma
• phosphodiesterase 6H, cGMP-specific, cone, gamma
• RCD3
• retinal cone rhodopsin-sensitive cGMP 3'-5'-cyclic phosphodiesterase subunitgamma

Background

Vision involves the conversion of light into electrochemical signals that are processed by the retina and subsequently sent to and interpreted by the brain. The process of converting light into an electrochemical signal begins when the membrane-bound protein, rhodopsin, absorbs light within the retina. Photoexcitation of rhodopsin causes the cytoplasmic surface of the protein to become catalytically active. In the active state, rhodopsin activates transducin, a GTP binding protein. Once activated, transducin promotes the hydrolysis of cGMP by phosphodiesterase (PDE). The decrease of intracellular cGMP concentration causes the ion channels within the outer segment of the rod or cone to close, thus causing membrane hyperpolarization and, eventually, signal transmission. Rhodopsin activity is believed to be shut off by phosphorylation followed by binding of the soluble protein, arrestin. Transducin, once activated by rhodopsin, promotes the hydrolysis of cGMP by PDE. The subunit composition of transducin differs between different photoreceptor cells. Rod transducin consists of rod transducin alpha (Tr alpha), T beta, and T gamma. Cone transducin is composed of cone transducin alpha (Tc alpha), T beta and T gamma. Differential transducin subunit composition of transducin is believed to be responsible for the different light sensitivities between photoreceptive cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PDE6H Antibody (NBP2-68659)(1)

Publication using NBP2-68659

• Yamasaki S, Tu H, Matsuyama T et al. A Genetic modification that reduces ON-bipolar cells in hESC-derived retinas enhances functional integration after transplantation iScience 2022-01-01 [PMID: 35024589] (IHC-Fr, Monkey)

Bioinformatics

• Gene Symbol: PDE6H