PDE6A Antibody

Images

 
Western Blot: PDE6A Antibody [NBP1-87312] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: PDE6A Antibody [NBP1-87312] - Staining of human retina shows moderate cytoplasmic positivity in rods.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-Fr, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PDE6A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TLMESLTQFLGWSVLNPDTYESMNKLENRKDIFQDIVKYHVKCDNEEIQKILKTREVYGKEPWECEEEELAEILQAELPDADKYEINKFHFSDLPLTELELVKCGIQMYYELKVVDKFHIPQEALVRFMYSLSKGYRKITYHN
Specificity
Specificity of human, mouse PDE6A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDE6A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Frozen 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Immunohistochemistry-Frozen reported in scientific literature (PMID: 29212391).
Control Peptide
PDE6A Protein (NBP1-87312PEP)
Publications
Read Publications using
NBP1-87312 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22412953). Mouse reactivity reported in scientific literature (PMID: 26188004)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PDE6A Antibody

  • CGPR-A
  • EC 3.1.4
  • EC 3.1.4.35
  • GMP-PDE alpha
  • PDE V-B1
  • PDEAcGMP phosphodiesterase alpha subunit
  • phosphodiesterase 6A, cGMP-specific, rod, alpha
  • rod cGMP-specific 3'-5'-cyclic phosphodiesterase subunit alpha
  • rod photoreceptor cGMP phosphodiesterase alpha subunit
  • RP43

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-5663
Species: Hu, Mu, Bv, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
AF591
Species: Mu
Applications: Flow, IHC, CyTOF-ready
H00005146-Q01
Species: Hu
NBP1-84412
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88908
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01353
Species: Hu
Applications: WB, IHC, IHC-P
PP-H7223-00
Species: Hu
Applications: WB, IHC, DirELISA
NBP2-56113
Species: Hu
Applications: WB, IHC, IHC-P
NB100-355
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, ICC
H00001406-M02
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF
NBP1-90038
Species: Hu, Ze
Applications: ICC/IF, IHC, IHC-P
AF2945
Species: Hu
Applications: WB
NBP1-30032
Species: Hu, Mu, Bv, Xp
Applications: WB, IHC, IHC-Fr
NBP2-58327
Species: Hu
Applications: WB, ICC/IF
NBP1-82549
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15304
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74389
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-87312
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P

Publications for PDE6A Antibody (NBP1-87312)(3)

Reviews for PDE6A Antibody (NBP1-87312) (0)

There are no reviews for PDE6A Antibody (NBP1-87312). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PDE6A Antibody (NBP1-87312) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PDE6A Antibody (NBP1-87312)

Discover related pathways, diseases and genes to PDE6A Antibody (NBP1-87312). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDE6A Antibody (NBP1-87312)

Discover more about diseases related to PDE6A Antibody (NBP1-87312).
 

Pathways for PDE6A Antibody (NBP1-87312)

View related products by pathway.

Research Areas for PDE6A Antibody (NBP1-87312)

Find related products by research area.

Blogs on PDE6A

There are no specific blogs for PDE6A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDE6A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDE6A