PDE6D Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

PDE6D Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PDE6D.
  
  

  Source: E. coli

  Amino Acid Sequence: KVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLLVSTSRVRL

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: PDE6D
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86275.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PDE6D Recombinant Protein Antigen

• GMP-PDE delta
• PDE6D
• PDED
• phosphodiesterase 6D, cGMP-specific, rod, delta
• Protein p17
• retinal rod rhodopsin-sensitive cGMP 3'-5'-cyclic phosphodiesterase subunitdelta

Background

PDE6D is the effector enzyme in the G protein-mediated signal transduction cascade in the visual system. The second messengers cAMP and cGMP are key regulatory molecules that are involved in a wide variety of signal transduction pathways, such as insulin secretion, platelet aggregation, smooth muscle relaxation, olfaction, and vision. Levels of cAMP and cGMP are regulated by their rate of synthesis by nucleotide cyclases and by their rate of hydrolysis by cyclic nucleotide phosphodiesterases (PDEs). PDEs form a superfamily of enzymes that catalyze the conversion of 3-prime, 5-prime-cyclic nucleotides to the corresponding nucleoside 5-prime-monophosphates. While mammalian PDEs are divided into major families based on their substrate specificities, kinetic properties, allosteric regulators, inhibitor sensitivities, and amino acid sequences, each family and even members within a family display distinct tissue, cell, and subcellular expression patters. This suggests that individual PDE family members are involved in discrete signal transduction pathways. There are five different subunits consisting of rod and cone specific catalytic subunits: alpha® (Cone), alpha (Rod), and beta (Rod), the inhibitory subunit gamma, and subunit delta of unknown function (which likely interacts with many other proteins besides the PDE6 family). The catalytic core of the PDE6 system is comprised of alpha®/alpha® homodimers in the cone and alpha/beta heterodimers in the rod. The C-terminus of both the catalytic and inhibitory subunits is modified by methylation, myristyolation and prenylation which have been shown to be critical for proper complex assembly and membrane association.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: PDE6D