PDE6A Antibody - BSA Free

Immunohistochemistry-Paraffin: PDE6A Antibody [NBP2-68985] - Staining of human endometrium shows no positivity in glandular cells as expected.

Immunohistochemistry: PDE6A Antibody [NBP2-68985] - Immunohistochemical staining of human retina shows strong cytoplasmic positivity in rods.

Immunohistochemistry-Paraffin: PDE6A Antibody [NBP2-68985] - Staining of human colon.

Immunohistochemistry-Paraffin: PDE6A Antibody [NBP2-68985] - Staining of human lymph node.

Immunohistochemistry-Paraffin: PDE6A Antibody [NBP2-68985] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: PDE6A Antibody [NBP2-68985] - Staining of human cerebral cortex, endometrium, eye, retina and liver using Anti-PDE6A antibody NBP2-68985 (A) shows similar protein distribution across tissues to independent antibody NBP1-87312 (B).

Immunohistochemistry-Paraffin: PDE6A Antibody [NBP2-68985] - Staining of human cerebral cortex shows no positivity in neurons as expected.

Immunohistochemistry-Paraffin: PDE6A Antibody [NBP2-68985] - Staining of human liver shows no positivity in hepatocytes as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PDE6A Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EEVEKFLDSNIGFAKQYYNLHYRAKLISDLLGAKEAAVDFSNYHSPSSMEESEIIFDLLRDFQENLQTEKCIFNVM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PDE6A
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: Recommended conditions for IHC,Retrieval method: HIER pH6
• Control Peptide:

  PDE6A Recombinant Protein Antigen (NBP2-68985PEP)

Reactivity Notes

Mouse 87%, Rat 86%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for PDE6A Antibody - BSA Free

• CGPR-A
• EC 3.1.4
• EC 3.1.4.35
• GMP-PDE alpha
• PDE V-B1
• PDE6A
• PDEA
• PDEAcGMP phosphodiesterase alpha subunit
• phosphodiesterase 6A, cGMP-specific, rod, alpha
• rod cGMP-specific 3'-5'-cyclic phosphodiesterase subunit alpha
• rod photoreceptor cGMP phosphodiesterase alpha subunit
• RP43

Background

Phosphodiesterase 6A, a catalytic subunit of the photoreceptor phosphodiesterase, has been shown to affect functioning of eye retina as the alpha subunit of the heterotetrameric rod photoreceptor. Mutations in PDE6A have been identified as a cause of autosomal recessive retinitis pigmentosa.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PDE6A