PDE12 Antibody

Images

 
Western Blot: PDE12 Antibody [NBP1-70672] - Sample Tissue: Human Jurkat Antibody Dilution: 1.0 ug/ml
Western Blot: PDE12 Antibody [NBP1-70672] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PDE12 Antibody Summary

Immunogen
Synthetic peptides corresponding to 2'-PDE The peptide sequence was selected from the middle region of 2'-PDE. Peptide sequence CLDYIFIDLNALEVEQVIPLPSHEEVTTHQALPSVSHPSDHIALVCDLKW.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDE12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against 2'-PDE and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PDE12 Antibody

  • 2'-PDE
  • phosphodiesterase 12

Background

2'-PDE is an enzyme that cleaves 2',5'-phosphodiester bond linking adenosines of the 5'-triphosphorylated oligoadenylates, triphosphorylated oligoadenylates referred as 2-5A modulates the 2-5A system. This enzyme degraded triphosphorylated 2-5A to produce AMP and ATP. 2'-PDE also cleaves 3',5'-phosphodiester bond of oligoadenylates. 2'-PDE play a role as a negative regulator of the 2-5A system that is one of the major pathways for antiviral and antitumor functions induced by interferons (IFNs). Suppression of this enzyme induces reduction of viral replication in Hela cells, thus counteracting the antiviral pathway probably by inhibiting the 2-5A system.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-351
Species: Hu, Ha, Pm, Mu(-), Rt(-)
Applications: WB, ELISA, IHC, IHC-P
NBP2-24567
Species: Hu
Applications: WB
H00004535-Q01
Species: Hu
AF1936
Species: Hu
Applications: WB, IP
AF5550
Species: Mu, Rt
Applications: WB
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
H00000518-R01
Species: Hu
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NB100-2323
Species: Hu, Mu, Rt, Po, Ma, Mk, Pm, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-32642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4937
Species: Hu
Applications: WB, IHC
AF2699
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
H00002729-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF

Publications for PDE12 Antibody (NBP1-70672) (0)

There are no publications for PDE12 Antibody (NBP1-70672).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDE12 Antibody (NBP1-70672) (0)

There are no reviews for PDE12 Antibody (NBP1-70672). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PDE12 Antibody (NBP1-70672) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PDE12 Products

Bioinformatics Tool for PDE12 Antibody (NBP1-70672)

Discover related pathways, diseases and genes to PDE12 Antibody (NBP1-70672). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDE12 Antibody (NBP1-70672)

Discover more about diseases related to PDE12 Antibody (NBP1-70672).
 

Pathways for PDE12 Antibody (NBP1-70672)

View related products by pathway.

Blogs on PDE12

There are no specific blogs for PDE12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDE12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDE12