TRPT1 Antibody

Images

 
Western Blot: TRPT1 Antibody [NBP1-81230] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: TRPT1 Antibody [NBP1-81230] - Staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRPT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ALADGIPFFRSANGVILTPGNTDGFLLPKYFKEALQLRPTRKPLSLAGDEETECQSSPKHSSRERRRIQQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRPT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TRPT1 Protein (NBP1-81230PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRPT1 Antibody

  • EC 2.7.1.160
  • MGC11134
  • tRNA 2'-phosphotransferase 1
  • tRNA phosphotransferase 1
  • tRNA splicing 2' phosphotransferase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2323
Species: Hu, Mu, Rt, Po, Ma, Mk, Pm, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB4648
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NB100-80861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TRPT1 Antibody (NBP1-81230) (0)

There are no publications for TRPT1 Antibody (NBP1-81230).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRPT1 Antibody (NBP1-81230) (0)

There are no reviews for TRPT1 Antibody (NBP1-81230). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRPT1 Antibody (NBP1-81230) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRPT1 Products

Bioinformatics Tool for TRPT1 Antibody (NBP1-81230)

Discover related pathways, diseases and genes to TRPT1 Antibody (NBP1-81230). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for TRPT1 Antibody (NBP1-81230)

View related products by pathway.

PTMs for TRPT1 Antibody (NBP1-81230)

Learn more about PTMs related to TRPT1 Antibody (NBP1-81230).

Blogs on TRPT1

There are no specific blogs for TRPT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRPT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRPT1