Recombinant Human PDCD10 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human PDCD10 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-212 of Human PDCD10 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
PDCD10
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
51.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PDCD10 Protein

  • apoptosis-related protein 15
  • cerebral cavernous malformations 3
  • MGC1212
  • MGC24477
  • programmed cell death 10
  • programmed cell death protein 10
  • TF-1 cell apoptosis-related protein 15
  • TFAR15CCM3Cerebral cavernous malformations 3 protein

Background

This gene encodes an evolutionarily conserved protein associated with cell apoptosis. The protein interacts with the serine/threonine protein kinase MST4 to modulate the extracellular signal-regulated kinase (ERK) pathway. It also interacts with and is phosphoryated by serine/threonine kinase 25, and is thought to function in a signaling pathway essential for vascular developent. Mutations in this gene are one cause of cerebral cavernous malformations, which are vascular malformations that cause seizures and cerebral hemorrhages. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-47405
Species: Hu
Applications: IHC, IHC-P
NBP1-86729
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-32670
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00051765-M02
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-87833
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
8475-OM/CF
Species: Hu
NBP2-22527
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-74571
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NBP2-65560
Species: Hu
NB100-56139
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-1269
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-67427
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84988
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
AF644
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP1-58359
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00011235-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for PDCD10 Recombinant Protein (H00011235-P01) (0)

There are no publications for PDCD10 Recombinant Protein (H00011235-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDCD10 Recombinant Protein (H00011235-P01) (0)

There are no reviews for PDCD10 Recombinant Protein (H00011235-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PDCD10 Recombinant Protein (H00011235-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for PDCD10 Recombinant Protein (H00011235-P01)

Discover related pathways, diseases and genes to PDCD10 Recombinant Protein (H00011235-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDCD10 Recombinant Protein (H00011235-P01)

Discover more about diseases related to PDCD10 Recombinant Protein (H00011235-P01).
 

Pathways for PDCD10 Recombinant Protein (H00011235-P01)

View related products by pathway.

PTMs for PDCD10 Recombinant Protein (H00011235-P01)

Learn more about PTMs related to PDCD10 Recombinant Protein (H00011235-P01).

Blogs on PDCD10

There are no specific blogs for PDCD10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PDCD10 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PDCD10