PCTAIRE1 Antibody (4D2)

Images

 
Western Blot: PCTAIRE1 Antibody (4D2) [H00005127-M01] - Analysis of PCTK1 expression in transfected 293T cell line by PCTK1 monoclonal antibody (M01), clone 4D2.Lane 1: PCTK1 transfected lysate(55.7 KDa).Lane 2: ...read more
Immunohistochemistry-Paraffin: PCTAIRE1 Antibody (4D2) [H00005127-M01] - Analysis of monoclonal antibody to PCTK1 on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
4D2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PCTAIRE1 Antibody (4D2) Summary

Immunogen
PCTK1 (AAH01048, 1 a.a. - 80 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDRMKKIKRQLSMTLRGGRGIDKTNGAPEQIGLDESGGGGGSDPGEAPTRAAPGELRSARGPLSSAPEIVHEDLKMGSDG
Specificity
PCTK1 - PCTAIRE protein kinase 1
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CDK16
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PCTAIRE1 Antibody (4D2)

  • Cell division protein kinase 16
  • cyclin-dependent kinase 16
  • EC 2.7.11
  • EC 2.7.11.22
  • FLJ16665
  • PCTAIRE protein kinase 1
  • PCTAIRE
  • PCTAIRE1
  • PCTAIRE-motif protein kinase 1
  • PCTGAIRE
  • PCTK1Serine/threonine-protein kinase PCTAIRE-1

Background

The protein encoded by this gene belongs to the cdc2/cdkx subfamily of the ser/thr family of protein kinases. It may play a role in signal transduction cascades in terminally differentiated cells. This gene is thought to escape X inactivation. Two transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88542
Species: Hu
Applications: IHC, IHC-P
NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32810
Species: Hu
Applications: WB, ICC/IF
AF7250
Species: Hu
Applications: IHC
NBP1-89530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2428
Species: Hu
Applications: WB
NBP1-88498
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3770
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-46209
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC-P, IP
NBP1-92564
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33063
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91931
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80920
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PCTAIRE1 Antibody (H00005127-M01) (0)

There are no publications for PCTAIRE1 Antibody (H00005127-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCTAIRE1 Antibody (H00005127-M01) (0)

There are no reviews for PCTAIRE1 Antibody (H00005127-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PCTAIRE1 Antibody (H00005127-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PCTAIRE1 Products

Bioinformatics Tool for PCTAIRE1 Antibody (H00005127-M01)

Discover related pathways, diseases and genes to PCTAIRE1 Antibody (H00005127-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCTAIRE1 Antibody (H00005127-M01)

Discover more about diseases related to PCTAIRE1 Antibody (H00005127-M01).
 

Pathways for PCTAIRE1 Antibody (H00005127-M01)

View related products by pathway.

PTMs for PCTAIRE1 Antibody (H00005127-M01)

Learn more about PTMs related to PCTAIRE1 Antibody (H00005127-M01).
 

Research Areas for PCTAIRE1 Antibody (H00005127-M01)

Find related products by research area.

Blogs on PCTAIRE1

There are no specific blogs for PCTAIRE1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCTAIRE1 Antibody (4D2) and receive a gift card or discount.

Bioinformatics

Gene Symbol CDK16
Entrez
OMIM
Uniprot