![Immunohistochemistry-Paraffin: PCLKC Antibody [NBP1-92246] - Staining of human small intestine shows positivity in apical membrane in glandular cells.](http://images.novusbio.com/fullsize/PCLKC-Antibody-Immunohistochemistry-Paraffin-NBP1-92246-img0014.jpg "Immunohistochemistry-Paraffin: PCLKC Antibody [NBP1-92246] - Staining of human small intestine shows positivity in apical membrane in glandular cells.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LDSTLQGTYQVTVQARDRPSLGPFLEATTTLNLFTVDQSYRSRLQFSTPKEEVGANRQAINAALTQATRTTVYIVDIQDIDSAARARPHSYLDAYFVFPNGSALTLDELSVMIRNDQDSLTQLLQLGLVVLGSQESQESDLSKQLISV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CDHR2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin: HIER pH 6 retrieval method is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Western_Blot_5100.jpg)
![Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Chromatin_Immunoprecipitation_11251.jpg)
![Simple Western beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/betaCatenin_AF1329_Simple_Western_17134.jpg)
![Simple Western CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Simple_Western_21377.jpg)
![Western Blot CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Western_Blot_21459.jpg)
![Immunohistochemistry CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Immunohistochemistry_17361.jpg)
![Intracellular Staining by Flow Cytometry Galectin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin-1_AF1152_Flow_Cytometry_11328.jpg)
![Simple Western Galectin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin1_AF1152_Simple_Western_16673.jpg)
![Immunohistochemistry Galectin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin-1_AF1152_Immunohistochemistry_6684.jpg)
| Publication using NBP1-92246 | Applications | Species |
|---|---|---|
| McConnell RE, Benesh AE, Mao S et al. Proteomic analysis of the enterocyte brush border. Am J Physiol Gastrointest Liver Physiol 2011-05-01 [PMID: 21330445] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: PCLKC Antibody [NBP1-92246] - Staining of human kidney shows moderate to strong membranous positivity in cells in tubules.](http://images.novusbio.com/fullsize/PCLKC-Antibody-Immunohistochemistry-Paraffin-NBP1-92246-img0008.jpg "Immunohistochemistry-Paraffin: PCLKC Antibody [NBP1-92246] - Staining of human kidney shows moderate to strong membranous positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: PCLKC Antibody [NBP1-92246] - Staining of human liver shows moderate to strong membranous positivity in hepatocytes.](http://images.novusbio.com/fullsize/PCLKC-Antibody-Immunohistochemistry-Paraffin-NBP1-92246-img0009.jpg "Immunohistochemistry-Paraffin: PCLKC Antibody [NBP1-92246] - Staining of human liver shows moderate to strong membranous positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: PCLKC Antibody [NBP1-92246] - Staining of human tonsil shows no membranous positivity as expected.](http://images.novusbio.com/fullsize/PCLKC-Antibody-Immunohistochemistry-Paraffin-NBP1-92246-img0011.jpg "Immunohistochemistry-Paraffin: PCLKC Antibody [NBP1-92246] - Staining of human tonsil shows no membranous positivity as expected.")
![N/A uPAR [HRP]](https://images.novusbio.com/images2/DATA_uPAR_DUP00_ELISA_866.jpg)
![N/A uPAR [HRP]](https://images.novusbio.com/images2/uPAR_DUP00_ELISA_203.jpg)
![Western Blot Galectin-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin3_AF1197_Western_Blot_21471.jpg)
![Immunohistochemistry Galectin-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin-3_AF1197_Immunohistochemistry_7115.jpg)
![Simple Western Galectin-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin3_AF1197_Simple_Western_18971.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")