PCGF1 Antibody - Azide and BSA Free Summary
Immunogen |
PCGF1 (AAH04952.1, 1 a.a. - 247 a.a.) full-length human protein. MRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDATTITECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLNLKLDRVMQDIVYKLVPGLQDSEEKRIREFYQSRGLDRVTQPTGEEPALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSVKEKRR |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PCGF1 |
Purity |
Protein G purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
This antibody is useful for Western Blot |
Reactivity Notes
This product is reactive against Human.
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.4) |
Preservative |
No Preservative |
Purity |
Protein G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for PCGF1 Antibody - Azide and BSA Free
Background
PCGF1 is a mammalian homolog of the Drosophila polycomb group genes, which act as transcriptional repressors to regulate anterior-posterior patterning in early embryonic development (Nunes et al., 2001 [PubMed 11287196]). See also PCGF2 (MIM 600346).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, I, Mu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
Species: Hu, Mu
Applications: ChIP, Flow-IC, Flow, ICC/IF, IP, WB
Species: Hu, Mu
Applications: ChIP, Flow-IC, Flow, ICC/IF, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Sh
Applications: ELISA, Flow, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Publications for PCGF1 Antibody (H00084759-D01P) (0)
There are no publications for PCGF1 Antibody (H00084759-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PCGF1 Antibody (H00084759-D01P) (0)
There are no reviews for PCGF1 Antibody (H00084759-D01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PCGF1 Antibody (H00084759-D01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PCGF1 Products
Research Areas for PCGF1 Antibody (H00084759-D01P)
Find related products by research area.
|
Blogs on PCGF1