Fibrinogen beta chain Antibody - BSA Free

Immunohistochemistry-Paraffin: Fibrinogen beta chain Antibody [NBP1-90956] - Staining of human cerebral cortex, liver, placenta and rectum using Fibrinogen beta chainantibody NBP1-90956 (A) shows similar protein distribution across tissues to independent antibody NBP1-90955 (B).

Western Blot: Fibrinogen beta chain Antibody [NBP1-90956] - Analysis using Fibrinogen beta chain antibody NBP1-90956 (A) shows similar pattern to independent antibody NBP1-90955 (B).

Immunocytochemistry/Immunofluorescence: Fibrinogen beta chain Antibody [NBP1-90956] - Staining of human cell line Hep G2 shows localization to endoplasmic reticulum. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Fibrinogen beta chain Antibody [NBP1-90956] - Staining of human rectum shows strong positivity in plasma in blood vessels, as well as positivity in extracellular matrix.

Immunohistochemistry-Paraffin: Fibrinogen beta chain Antibody [NBP1-90956] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: Fibrinogen beta chain Antibody [NBP1-90956] - Staining of human cerebral cortex shows no positivity in neurons as expected.

Immunohistochemistry-Paraffin: Fibrinogen beta chain Antibody [NBP1-90956] - Staining of human placenta shows strong positivity in plasma in blood vessels.

Analysis in human liver tissue.

Staining of human liver shows weak to moderate cytoplasmic positivity in hepatocytes.

Staining of human cell line Hep G2 shows localization to endoplasmic reticulum.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Fibrinogen beta chain Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Fibrinogen beta chain Antibody - BSA Free (NBP1-90956) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Fibrinogen beta chain Antibody: Cited in 5 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ERKAPDAGGCLHADPDLGVLCPTGCQLQEALLQQERPIRNSVDELNNNVEAVSQTSSSSFQYMYLLKDLWQKRQKQVKDNENVVNEYSSELEKHQLYIDETVNSNIPTNLRVLRSILENLRSKIQKLE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FGB
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:5000 -1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100
• Control Peptide:

  Fibrinopeptide B Protein (NBP1-90956PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Fibrinogen beta chain Antibody - BSA Free

• Beta-Fibrinogen
• epididymis secretory sperm binding protein Li 78p
• fibrinogen beta chain
• fibrinogen, B beta polypeptide
• HEL-S-78p
• MGC104327
• MGC120405

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Fibrinogen beta chain Antibody (NBP1-90956)(5)

Publications using NBP1-90956

• Qundos U, Hong MG, Tybring G et al. Profiling post-centrifugation delay of serum and plasma with antibody bead arrays. J Proteomics 2013-12-16 [PMID: 23631827]
• Linden M, Segersten U, Runeson M et al. Tumour expression of bladder cancer-associated urinary proteins. BJU Int 2013-08-01 [PMID: 23470167]
• Kato BS, Nicholson G, Neiman M et al. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Sci 2011-11-17 [PMID: 22093360]
• Haggmark A, Neiman M, Drobin K et al. Classification of protein profiles from antibody microarrays using heat and detergent treatment. N Biotechnol 2012-06-01 [PMID: 22023822]
• Gonzalez RM, Zhang Q, Zangar RC et al. Development of a fibrinogen-specific sandwich enzyme-linked immunosorbent assay microarray assay for distinguishing between blood plasma and serum samples. Anal Biochem 2011-07-01 [PMID: 21371419]

Bioinformatics

• Gene Symbol: FGB