PBXIP1 Antibody

Images

 
Immunohistochemistry-Paraffin: PBXIP1 Antibody [NBP1-83222] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PBXIP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SLPVETLGPASRMDPESERALQAPHSPSKTDGKELAGTMDGEGTLFQTESPQSGSILTEETEVKGTLEGDVCGVEPPGPGDTVVQGDLQETTVVTGLGPDTQDLEGQSPPQSLPSTPKAAWIR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PBXIP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PBXIP1 Protein (NBP1-83222PEP)
Publications
Read Publication using
NBP1-83222 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24470547).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PBXIP1 Antibody

  • Hematopoietic PBX-interacting protein
  • HPIPpre-B-cell leukemia transcription factor interacting protein 1
  • pre-B-cell leukemia homeobox interacting protein 1
  • pre-B-cell leukemia transcription factor-interacting protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB17791
Species: Hu, Mu
Applications: WB
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-305
Species: Hu, Mu, Mk
Applications: WB, ChIP, DB, Flow, ICC/IF, IHC, IHC-P, IP
H00005090-M01
Species: Hu
Applications: WB, ELISA, IHC-P
AF6116
Species: Hu
Applications: WB, ICC
NBP2-52911
Species: Hu
Applications: WB, IHC, IHC-P
MAB7650
Species: Mu
Applications: WB, IHC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP1-83222
Species: Hu
Applications: IHC, IHC-P

Publications for PBXIP1 Antibody (NBP1-83222)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for PBXIP1 Antibody (NBP1-83222) (0)

There are no reviews for PBXIP1 Antibody (NBP1-83222). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PBXIP1 Antibody (NBP1-83222) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PBXIP1 Products

Bioinformatics Tool for PBXIP1 Antibody (NBP1-83222)

Discover related pathways, diseases and genes to PBXIP1 Antibody (NBP1-83222). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PBXIP1 Antibody (NBP1-83222)

Discover more about diseases related to PBXIP1 Antibody (NBP1-83222).
 

Pathways for PBXIP1 Antibody (NBP1-83222)

View related products by pathway.

PTMs for PBXIP1 Antibody (NBP1-83222)

Learn more about PTMs related to PBXIP1 Antibody (NBP1-83222).

Blogs on PBXIP1

There are no specific blogs for PBXIP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PBXIP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PBXIP1