Pax7 Antibody (3C9)

Images

 
Western Blot: Pax7 Antibody (3C9) [H00005081-M03] - Analysis of PAX7 expression in PC-12 (Cat # L012V1).
Western Blot: Pax7 Antibody (3C9) [H00005081-M03] - Analysis of PAX7 expression in HeLa (Cat # L013V1).
Western Blot: Pax7 Antibody (3C9) [H00005081-M03] - Analysis of PAX7 expression in Raw 264.7 (Cat # L024V1).
Sandwich ELISA: Pax7 Antibody (3C9) [H00005081-M03] - Detection limit for recombinant GST tagged PAX7 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA
Clone
3C9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Pax7 Antibody (3C9) Summary

Immunogen
PAX7 (NP_002575.1 411 a.a. - 520 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTTGYSVDPVAGYQYGQYGQSECLVPWASPVPIPSPTPRASCLFMESYKVVSGWGMSISQMEKLKSSQMEQFT
Specificity
PAX7 - paired box gene 7
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PAX7
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Pax7 Antibody (3C9)

  • FLJ37460
  • HUP1
  • paired box 7
  • paired box gene 7
  • paired box homeotic gene 7
  • paired box protein Pax-7
  • paired domain gene 7
  • PAX7 transcriptional factor
  • Pax7
  • PAX7B
  • RMS2

Background

This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box 7 gene is unknown but speculated to involve tumor suppression since fusion of this gene with a forkhead domain family member has been associated with alveolar rhabdomyosarcoma. Alternative splicing in this gene has produced two known products but the biological significance of the variants is unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2457
Species: Hu, Mu
Applications: WB, CyTOF-ready, ICC, ICFlow
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-31376
Species: Hu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-44245
Species: Hu
Applications: WB, IHC, IHC-P
NB120-15200
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-31216
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
H00005081-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA

Publications for Pax7 Antibody (H00005081-M03) (0)

There are no publications for Pax7 Antibody (H00005081-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pax7 Antibody (H00005081-M03) (0)

There are no reviews for Pax7 Antibody (H00005081-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Pax7 Antibody (H00005081-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Pax7 Products

Bioinformatics Tool for Pax7 Antibody (H00005081-M03)

Discover related pathways, diseases and genes to Pax7 Antibody (H00005081-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pax7 Antibody (H00005081-M03)

Discover more about diseases related to Pax7 Antibody (H00005081-M03).
 

Pathways for Pax7 Antibody (H00005081-M03)

View related products by pathway.

PTMs for Pax7 Antibody (H00005081-M03)

Learn more about PTMs related to Pax7 Antibody (H00005081-M03).
 

Research Areas for Pax7 Antibody (H00005081-M03)

Find related products by research area.

Blogs on Pax7

There are no specific blogs for Pax7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pax7 Antibody (3C9) and receive a gift card or discount.

Bioinformatics

Gene Symbol PAX7
Entrez
OMIM
Uniprot