PAX1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit PAX1 Antibody - BSA Free (NBP3-10315) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human PAX1 (NP_006183). Peptide sequence AGVNRTAFPATPAVNGLEKPALEADIKYTQSASTLSAVGGFLPACAYPAS |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PAX1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
46 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for PAX1 Antibody - BSA Free
Background
Paxillin is a 64 kDa cytoskeletal adapter protein involved in organisation and function of focal adhesions, which are critical to cell adhesion and migration. This in turn plays a role in a wide variety of processes including embryogenesis, organogenesis, wound repair, inflammation and cancer. Paxillin contains LD motifs, LIM domains, SH3 and SH2 binding domains that serve as docking sites for cytoskeletal proteins, tyrosine kinases (e.g., FAK, Pyk 2, Src), serine/threonine kinases, GTPase activating proteins and other adaptor proteins (e.g., Actin, Vinculin, Crk).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rt
Applications: ELISA, KD, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, WB
Species: Mu
Applications: BA
Species: Hu
Applications: BA, BA
Species: Hu, Mu
Applications: BA
Species: Hu
Applications: Flow, ICC/IF
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ChIP, ICC, IHC, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Av, Bv, Sh
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, IP, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: WB
Publications for PAX1 Antibody (NBP3-10315) (0)
There are no publications for PAX1 Antibody (NBP3-10315).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PAX1 Antibody (NBP3-10315) (0)
There are no reviews for PAX1 Antibody (NBP3-10315).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PAX1 Antibody (NBP3-10315) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PAX1 Products
Blogs on PAX1