PAX1 Antibody - BSA Free

Western Blot: PAX1 Antibody [NBP3-10315] - Western blot analysis using NBP3-10315 on Human MCF-7 as a positive control. Antibody Titration: 0.2-1 ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PAX1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PAX1 Antibody - BSA Free (NBP3-10315) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PAX1 (NP_006183). Peptide sequence AGVNRTAFPATPAVNGLEKPALEADIKYTQSASTLSAVGGFLPACAYPAS
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PAX1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 46 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PAX1 Antibody - BSA Free

• paired box 1
• paired domain gene HuP48

Background

Paxillin is a 64 kDa cytoskeletal adapter protein involved in organisation and function of focal adhesions, which are critical to cell adhesion and migration. This in turn plays a role in a wide variety of processes including embryogenesis, organogenesis, wound repair, inflammation and cancer. Paxillin contains LD motifs, LIM domains, SH3 and SH2 binding domains that serve as docking sites for cytoskeletal proteins, tyrosine kinases (e.g., FAK, Pyk 2, Src), serine/threonine kinases, GTPase activating proteins and other adaptor proteins (e.g., Actin, Vinculin, Crk).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PAX1