PATZ Recombinant Protein Antigen

Images

 
There are currently no images for PATZ Recombinant Protein Antigen (NBP2-48884PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PATZ Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PATZ.

Source: E. coli

Amino Acid Sequence: LLDSMFGSPGGLREAGILPCGLCGKVFTDANRLRQHEAQHGVTSLQLGYIDLPPPRLGENGLPISEDPDGPRKRSRTRKQVACEI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PATZ1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48884.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PATZ Recombinant Protein Antigen

  • dJ400N23
  • MAZRPOZ-, AT hook-, and zinc finger-containing protein 1
  • PATZZinc finger and BTB domain-containing protein 19
  • POZ (BTB) and AT hook containing zinc finger 1
  • Protein kinase A RI subunit alpha-associated protein
  • RIAZBTB/POZ domain zinc finger transcription factor
  • ZBTB19BTB-POZ domain zinc finger transcription factor
  • Zinc finger protein 278Zinc finger sarcoma gene protein
  • ZNF278POZ-AT hook-zinc finger protein
  • ZSGMAZ-related factor

Background

PATZ is encoded by this gene contains an A-T hook DNA binding motif which usually binds to other DNA binding structures to play an important role in chromatin modeling and transcription regulation. Its Poz domain is thought to function as a site for protein-protein interaction and is required for transcriptional repression, and the zinc-fingers comprise the DNA binding domain. Since the encoded protein has typical features of a transcription factor, it is postulated to be a repressor of gene expression. In small round cell sarcoma, this gene is fused to EWS by a small inversion of 22q, then the hybrid is thought to be translocated (t(1;22)(p36.1;q12). The rearrangement of chromosome 22 involves intron 8 of EWS and exon 1 of this gene creating a chimeric sequence containing the transactivation domain of EWS fused to zinc finger domain of this protein. This is a distinct example of an intra-chromosomal rearrangement of chromosome 22. Four alternatively spliced transcript variants are described for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-182
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, Simple Western, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
H00006047-A01
Species: Hu
Applications: ELISA, IP, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP1-93442
Species: Hu
Applications: IHC,  IHC-P
NBP2-59786
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western
NBP3-16379
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, WB
MAB7185
Species: Hu
Applications: Simple Western, WB
NB100-836
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NB100-86984
Species: Hu, Mu
Applications: ChIP, IHC,  IHC-P, IP, KD, WB
NB600-1335
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NBP2-15108
Species: Hu, Mu, Rt
Applications: ChIP, IHC,  IHC-P, WB
NBP2-14345
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87866
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-23927
Species: Hu
Applications:  IHC-P
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
NBP1-85525
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-48884PEP
Species: Hu
Applications: AC

Publications for PATZ Recombinant Protein Antigen (NBP2-48884PEP) (0)

There are no publications for PATZ Recombinant Protein Antigen (NBP2-48884PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PATZ Recombinant Protein Antigen (NBP2-48884PEP) (0)

There are no reviews for PATZ Recombinant Protein Antigen (NBP2-48884PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PATZ Recombinant Protein Antigen (NBP2-48884PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PATZ Products

Blogs on PATZ

There are no specific blogs for PATZ, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PATZ Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PATZ1