We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human PATZ GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human PATZ GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 260-358 of Human PATZ

Source: Wheat Germ (in vitro)

Amino Acid Sequence: PLTGKRGRGRPRKANLLDSMFGSPGGLREAGILPCGLCGKVFTDANRLRQHEAQHGVTSLQLGYIDLPPPRLGENGLPISEDPDGPRKRSRTRKQVACE

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
PATZ1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PATZ GST (N-Term) Protein

  • dJ400N23
  • MAZRPOZ-, AT hook-, and zinc finger-containing protein 1
  • PATZZinc finger and BTB domain-containing protein 19
  • POZ (BTB) and AT hook containing zinc finger 1
  • Protein kinase A RI subunit alpha-associated protein
  • RIAZBTB/POZ domain zinc finger transcription factor
  • ZBTB19BTB-POZ domain zinc finger transcription factor
  • Zinc finger protein 278Zinc finger sarcoma gene protein
  • ZNF278POZ-AT hook-zinc finger protein
  • ZSGMAZ-related factor

Background

The protein encoded by this gene contains an A-T hook DNA binding motif which usually binds to other DNA binding structures to play an important role in chromatin modeling and transcription regulation. Its Poz domain is thought to function as a site for protein-protein interaction and is required for transcriptional repression, and the zinc-fingers comprise the DNA binding domain. Since the encoded protein has typical features of a transcription factor, it is postulated to be a repressor of gene expression. In small round cell sarcoma, this gene is fused to EWS by a small inversion of 22q, then the hybrid is thought to be translocated (t(1;22)(p36.1;q12). The rearrangement of chromosome 22 involves intron 8 of EWS and exon 1 of this gene creating a chimeric sequence containing the transactivation domain of EWS fused to zinc finger domain of this protein. This is a distinct example of an intra-chromosomal rearrangement of chromosome 22. Four alternatively spliced transcript variants are described for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92686
Species: Ca, Eq, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
H00006047-A01
Species: Hu
Applications: ELISA, IP, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP1-93442
Species: Hu
Applications: IHC,  IHC-P
NBP2-59786
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western
NBP3-16379
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, WB
MAB7185
Species: Hu
Applications: Simple Western, WB
NB100-836
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NB100-86984
Species: Hu, Mu
Applications: ChIP, IHC,  IHC-P, IP, KD, WB
NB600-1335
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NBP2-15108
Species: Hu, Mu, Rt
Applications: ChIP, IHC,  IHC-P, WB
NBP2-34229
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87866
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-23927
Species: Hu
Applications:  IHC-P
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
NBP1-85525
Species: Hu
Applications: IHC,  IHC-P, WB
H00023598-Q01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for PATZ Partial Recombinant Protein (H00023598-Q01) (0)

There are no publications for PATZ Partial Recombinant Protein (H00023598-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PATZ Partial Recombinant Protein (H00023598-Q01) (0)

There are no reviews for PATZ Partial Recombinant Protein (H00023598-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PATZ Partial Recombinant Protein (H00023598-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PATZ Products

Blogs on PATZ

There are no specific blogs for PATZ, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PATZ GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PATZ1