PATL1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PATL1 Antibody [NBP1-93808] - Staining of human cell line A-431 shows localization to cytoplasmic bodies. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PATL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QHRRLLHQRQQQNRSQHRNLNGAGDRGSHRSSHQDHLRKDPYANLMLQREKDWVSKIQMMQLQSTDPYLDDFYYQNYFEKLEKLSAAEEIQGDGPKKE
Predicted Species
Mouse (94%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PATL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PATL1 Protein (NBP1-93808PEP)
Publications
Read Publication using NBP1-93808.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PATL1 Antibody

  • FLJ36874
  • hPat1b
  • MGC125671
  • OK/KNS-cl.5
  • Pat1b
  • PAT1-like protein 1
  • protein associated with topoisomerase II homolog 1 (yeast)
  • protein PAT1 homolog 1
  • protein PAT1 homolog b

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-191
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-80524
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-81781
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-00918
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00080122-M01
Species: Hu
Applications: ELISA, ICC/IF
NBP1-31164
Species: Hu
Applications: ICC/IF, WB
NB500-191
Species: Hu, Mu
Applications: IP, WB
NBP1-87381
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF7284
Species: Hu, Mu, Rt
Applications: IHC, WB
H00055802-M06
Species: Hu, I, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, PLA, WB
NB100-1556
Species: Hu, Mu, Rt
Applications: ICC, IHC, IHC-P, IP, WB
AF4094
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP2-13944
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-16109
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC, IHC-P, ISH, WB
AF6015
Species: Hu, Mu, Rt
Applications: WB
H00056478-B01P
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IP, WB
NBP2-93867
Species: Hu, Mu, Rt
Applications: WB
NBP3-16473
Species: Hu, Mu, Rt
Applications: ICC/IF, WB

Publications for PATL1 Antibody (NBP1-93808)(1)

Reviews for PATL1 Antibody (NBP1-93808) (0)

There are no reviews for PATL1 Antibody (NBP1-93808). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PATL1 Antibody (NBP1-93808) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PATL1 Products

Bioinformatics Tool for PATL1 Antibody (NBP1-93808)

Discover related pathways, diseases and genes to PATL1 Antibody (NBP1-93808). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PATL1 Antibody (NBP1-93808)

Discover more about diseases related to PATL1 Antibody (NBP1-93808).
 

Pathways for PATL1 Antibody (NBP1-93808)

View related products by pathway.

PTMs for PATL1 Antibody (NBP1-93808)

Learn more about PTMs related to PATL1 Antibody (NBP1-93808).

Blogs on PATL1

There are no specific blogs for PATL1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PATL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PATL1