![Western Blot: Parvin gamma Antibody [H00064098-B01P] - Western Blot analysis of Parvin gamma expression in transfected 293T cell line by PARVG MaxPab polyclonal antibody. Lane 1: PARVG transfected lysate (36. 41 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/Parvin-gamma-Antibody-Western-Blot-H00064098-B01P-img0005.jpg "Western Blot: Parvin gamma Antibody [H00064098-B01P] - Western Blot analysis of Parvin gamma expression in transfected 293T cell line by PARVG MaxPab polyclonal antibody. Lane 1: PARVG transfected lysate (36. 41 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IP |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse Parvin gamma Antibody - Azide and BSA Free (H00064098-B01P) is a polyclonal antibody validated for use in WB and IP. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | PARVG (NP_071424.1, 1 a.a. - 331 a.a.) full-length human protein. MEPEFLYDLLQLPKGVEPPAEEELSKGGKKKYLPPTSRKDPKFEELQKVLMEWINATLLPEHIVVRSLEEDMFDGLILHHLFQRLAALKLEAEDIALTATSQKHKLTVVLEAVNRSLQLEEWQAKWSVESIFNKDLLSTLHLLVALAKRFQPDLSLPTNVQVEVITIESTKSGLKSEKLVEQLTEYSTDKDEPPKDVFDELFKLAPEKVNAVKEAIVNFVNQKLDRLGLSVQNLDTQFADGVILLLLIGQLEGFFLHLKEFYLTPNSPAEMLHNVTLALELLKDEGLLSCPVSPEDIVNKDAKSTLRVLYGLFCKHTQKAHRDRTPHGAPN |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | PARVG |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This antibody is useful for Western Blot, Functional |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
![Western Blot PTEN Antibody [Unconjugated]](https://images.novusbio.com/images2/PTEN_AF847_Western_Blot_5922.jpg)
![Simple Western PTEN Antibody [Unconjugated]](https://images.novusbio.com/images2/16342.jpg)
![Knockout Validated PTEN Antibody [Unconjugated]](https://images.novusbio.com/images2/PTEN_AF847_Knockout_Validated_22996.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Parvin gamma Antibody (H00064098-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PARVG |
| Uniprot |
|
![Western Blot: Parvin gamma Antibody [H00064098-B01P] - Analysis of PARVG expression in human spleen.](http://images.novusbio.com/fullsize/Parvin-gamma-Antibody-Western-Blot-H00064098-B01P-img0002.jpg "Western Blot: Parvin gamma Antibody [H00064098-B01P] - Analysis of PARVG expression in human spleen.")
![Western Blot: Parvin gamma Antibody [H00064098-B01P] - Analysis of PARVG expression in transfected 293T cell line by PARVG polyclonal antibody. Lane 1: PARVG transfected lysate(36.41 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/Parvin-gamma-Antibody-Western-Blot-H00064098-B01P-img0003.jpg "Western Blot: Parvin gamma Antibody [H00064098-B01P] - Analysis of PARVG expression in transfected 293T cell line by PARVG polyclonal antibody. Lane 1: PARVG transfected lysate(36.41 KDa). Lane 2: Non-transfected lysate.")
![Immunoprecipitation: Parvin gamma Antibody [H00064098-B01P] - Immunoprecipitation of Parvin gamma transfected lysate using anti-PARVG MaxPab mouse polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with PARVG purified MaxPab rabbit polyclonal antibody.](http://images.novusbio.com/fullsize/Parvin-gamma-Antibody-Immunoprecipitation-H00064098-B01P-img0004.jpg "Immunoprecipitation: Parvin gamma Antibody [H00064098-B01P] - Immunoprecipitation of Parvin gamma transfected lysate using anti-PARVG MaxPab mouse polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with PARVG purified MaxPab rabbit polyclonal antibody.")
![Immunocytochemistry Paxillin Antibody [Unconjugated]](https://images.novusbio.com/images2/Paxillin_AF4259_Immunocytochemistry_10249.jpg)
![Western Blot Paxillin Antibody [Unconjugated]](https://images.novusbio.com/images2/Paxillin_AF4259_Western_Blot_5429.jpg)
![Simple Western Paxillin Antibody [Unconjugated]](https://images.novusbio.com/images2/Paxillin_AF4259_Simple_Western_17510.jpg)
![N/A FGF-19 [HRP]](https://images.novusbio.com/images2/DATA_FGF19_DF1900_ELISA_664.jpg)
![N/A FGF-19 [HRP]](https://images.novusbio.com/images2/FGF-19_DF1900_ELISA_90.jpg)
![Western Blot NKX2.5 Antibody [Unconjugated]](https://images.novusbio.com/images/af2444_human-nkx2-5-affinity-purified-polyclonal-ab-4120241239327.jpg)
![Immunocytochemistry/ Immunofluorescence NKX2.5 Antibody [Unconjugated]](https://images.novusbio.com/images/af2444_human-nkx2-5-affinity-purified-polyclonal-ab-41202412401270.jpg)
![Immunocytochemistry/ Immunofluorescence NKX2.5 Antibody [Unconjugated]](https://images.novusbio.com/images/af2444_human-nkx2-5-affinity-purified-polyclonal-ab-41202412403531.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")