Parvalbumin Recombinant Protein Antigen

Images

 
There are currently no images for Parvalbumin Protein (NBP2-33529PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Parvalbumin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PVALB.

Source: E. coli

Amino Acid Sequence: ATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PVALB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33529.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Parvalbumin Recombinant Protein Antigen

  • D22S749
  • MGC116759
  • parvalbumin alpha
  • parvalbumin
  • PV

Background

Parvalbumin is encoded by this gene is a high affinity calcium ion-binding protein that is structurally and functionally similar to calmodulin and troponin C. The encoded protein is thought to be involved in muscle relaxation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-50028
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC,  IHC-P, WB
NBP1-88220
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P
AF2086
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-88191
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-30052
Species: Ch, Gp, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, WB
NBP1-46535
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NBP2-62664
Species: Hu
Applications: IHC,  IHC-P
AF2185
Species: Hu, Mu, Rt
Applications: IP, WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
DBD00
Species: Hu
Applications: ELISA
NBP1-31329
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-33529PEP
Species: Hu
Applications: AC

Publications for Parvalbumin Protein (NBP2-33529PEP) (0)

There are no publications for Parvalbumin Protein (NBP2-33529PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Parvalbumin Protein (NBP2-33529PEP) (0)

There are no reviews for Parvalbumin Protein (NBP2-33529PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Parvalbumin Protein (NBP2-33529PEP). (Showing 1 - 1 of 1 FAQ).

  1. I am doing research on Neuroscience and I would like to use some antibodies, especially in Western Blots, but I could do other assays: - alpha7 nicotinic cholinergic receptor; - parvalbumin; - calbindin D28K; The preferred reactivity is anti-human and anti-mouse. Do you have these antibodies? Are they in stock? And what about the prizes: How much are they? How much are the shipping costs? Could you make me any offer?
    • We currently have three alpha7 nicotinic cholingergic receptor antibodies available for purchase. Please see this list for our Parvalbumin antibodies. None are currently validated in mouse. I would like to introduce you to our Innovators Reward Program. We have an excelent calbinin D28K antibody that has been validated for use in human and mouse and WB. The pricing and availability of our products depends on your country.

Additional Parvalbumin Products

Research Areas for Parvalbumin Protein (NBP2-33529PEP)

Find related products by research area.

Blogs on Parvalbumin.

Successful Transplantation of Friedreich Ataxia Induced Pluripotent Stem Cell (iPSC)-Derived Sensory Neurons in Dorsal Root Ganglia of Adult Rodents
Jamshed Arslan, Pharm D, PhD The dorsal root ganglia (DRG) are a collection of cell bodies of sensory nerves carrying sensory information – including nociception, mechanoreception and proprioception – from periphera...  Read full blog post.

Customers Who Bought This Also Bought

GFAP Antibody
NB300-141

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Parvalbumin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PVALB