PARP12 Antibody - Azide and BSA Free Summary
| Description |
Novus Biologicals Rabbit PARP12 Antibody - Azide and BSA Free (NBP2-93240) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 462-701 of human PARP12 (NP_073587.1). YVSPQDVTTMQTCNTKFPGPKSIPDYWDSSALPDPGFQKITLSSSSEEYQKVWNLFNRTLPFYFVQKIERVQNLALWEVYQWQKGQMQKQNGGKAVDERQLFHGTSAIFVDAICQQNFDWRVCGVHGTSYGKGSYFARDAAYSHHYSKSDTQTHTMFLARVLVGEFVRGNASFVRPPAKEGWSNAFYDSCVNSVSDPSIFVIFEKHQVYPEYVIQYTTSSKPSVTPSILLALGSLFSSRQ |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PARP12 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500-1:2000
|
| Theoretical MW |
79 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for PARP12 Antibody - Azide and BSA Free
Background
Poly (ADP-ribose) polymerase (PARP) catalyzes the post-translational modification of proteins by the addition ofmultiple ADP-ribose moieties. PARP transfers ADP-ribose from nicotinamide dinucleotide (NAD) to glu/asp residues onthe substrate protein, and also polymerizes ADP-ribose to form long/branched chain polymers. PARP inhibitors are beingdeveloped for use in a number of pathologies including cancer, diabetes, stroke and cardiovascular disease.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: B/N, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vivo
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Species: Bv, Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Xp
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for PARP12 Antibody (NBP2-93240) (0)
There are no publications for PARP12 Antibody (NBP2-93240).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PARP12 Antibody (NBP2-93240) (0)
There are no reviews for PARP12 Antibody (NBP2-93240).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PARP12 Antibody (NBP2-93240) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PARP12 Products
Research Areas for PARP12 Antibody (NBP2-93240)
Find related products by research area.
|
Blogs on PARP12