PARN Antibody

Images

 
Western Blot: PARN Antibody [H00005073-B01P] - Analysis of PARN expression in NIH/3T3.
Immunocytochemistry/ Immunofluorescence: PARN Antibody [H00005073-B01P] - Analysis of purified antibody to PARN on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: PARN Antibody [H00005073-B01P] - N MaxPab polyclonal antibody. Western Blot analysis of PARN expression in Hela NE.
Western Blot: PARN Antibody [H00005073-B01P] - Analysis of PARN expression in PC-12.
Western Blot: PARN Antibody [H00005073-B01P] - Analysis of PARN expression in Hela S3 NE.
Western Blot: PARN Antibody [H00005073-B01P] - Analysis of PARN expression in Raw 264.7.
Western Blot: PARN Antibody [H00005073-B01P] - Analysis of PARN expression in transfected 293T cell line by PARN polyclonal antibody. Lane 1: PARN transfected lysate(70.29 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PARN Antibody Summary

Immunogen
PARN (NP_002573.1, 1 a.a. - 639 a.a.) full-length human protein. MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFNKLFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVKIAVNTSKYAESYRIQTYAEYMGRKQEEKQIKRKWTEDSWKEADSKRLNPQCIPYTLQNHYYRNNSFTAPSTVGKRNLSPSQEEAGLEDGVSGEISDTELEQTDSCAEPLSEGRKKAKKLKRMKKELSPAGSISKNSPATLFEVPDTW
Specificity
PARN - poly(A)-specific ribonuclease (deadenylation nuclease),
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
PARN
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It is also useful for IF.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PARN Antibody

  • DANEC 3.1.13.4
  • Deadenylating nuclease
  • Deadenylation nuclease
  • poly(A)-specific ribonuclease (deadenylation nuclease)
  • poly(A)-specific ribonuclease PARN
  • Polyadenylate-specific ribonuclease

Background

The protein encoded by this gene is a 3'-exoribonuclease, with similarity to the RNase D family of 3'-exonucleases. It prefers poly(A) as the substrate, hence, efficiently degrades poly(A) tails of mRNAs. Exonucleolytic degradation of the poly(A) tail is often the first step in the decay of eukaryotic mRNAs. This protein is also involved in silencing of certain maternal mRNAs during oocyte maturation and early embryonic development, as well as in nonsense-mediated decay (NMD) of mRNAs that contain premature stop codons. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56883
Species: Hu
Applications: IHC, IHC-P
AF755
Species: Mu
Applications: WB, Block
AF2069
Species: Mu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF1986
Species: Mu
Applications: WB
NBP2-37856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86564
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00064506-D01P
Species: Hu, Mu
Applications: WB, ELISA
NBP2-15930
Species: Hu
Applications: WB, ICC/IF
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
MAB1567
Species: Hu
Applications: Flow, CyTOF-reported
355-BM/CF
Species: Hu, Mu, Rt
H00029883-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-02105
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB120-6125
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
NBP1-83411
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005073-B01P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for PARN Antibody (H00005073-B01P) (0)

There are no publications for PARN Antibody (H00005073-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PARN Antibody (H00005073-B01P) (0)

There are no reviews for PARN Antibody (H00005073-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PARN Antibody (H00005073-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PARN Antibody (H00005073-B01P)

Discover related pathways, diseases and genes to PARN Antibody (H00005073-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PARN Antibody (H00005073-B01P)

Discover more about diseases related to PARN Antibody (H00005073-B01P).
 

Pathways for PARN Antibody (H00005073-B01P)

View related products by pathway.

PTMs for PARN Antibody (H00005073-B01P)

Learn more about PTMs related to PARN Antibody (H00005073-B01P).

Blogs on PARN

There are no specific blogs for PARN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PARN Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PARN
Entrez
Uniprot