PARN Antibody - Azide and BSA Free

Western Blot: PARN Antibody [H00005073-B01P] - Analysis of PARN expression in NIH/3T3.

Immunocytochemistry/Immunofluorescence: PARN Antibody [H00005073-B01P] - Analysis of purified antibody to PARN on HeLa cell. (antibody concentration 10 ug/ml)

Western Blot: PARN Antibody [H00005073-B01P] - N MaxPab polyclonal antibody. Western Blot analysis of PARN expression in Hela NE.

Western Blot: PARN Antibody [H00005073-B01P] - Analysis of PARN expression in PC-12.

Western Blot: PARN Antibody [H00005073-B01P] - Analysis of PARN expression in Hela S3 NE.

Western Blot: PARN Antibody [H00005073-B01P] - Analysis of PARN expression in Raw 264.7.

Western Blot: PARN Antibody [H00005073-B01P] - Analysis of PARN expression in transfected 293T cell line by PARN polyclonal antibody. Lane 1: PARN transfected lysate(70.29 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PARN Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: PARN (NP_002573.1, 1 a.a. - 639 a.a.) full-length human protein. MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFNKLFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVKIAVNTSKYAESYRIQTYAEYMGRKQEEKQIKRKWTEDSWKEADSKRLNPQCIPYTLQNHYYRNNSFTAPSTVGKRNLSPSQEEAGLEDGVSGEISDTELEQTDSCAEPLSEGRKKAKKLKRMKKELSPAGSISKNSPATLFEVPDTW
• Specificity: PARN - poly(A)-specific ribonuclease (deadenylation nuclease),
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: PARN
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It is also useful for IF.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PARN Antibody - Azide and BSA Free

• DANEC 3.1.13.4
• Deadenylating nuclease
• Deadenylation nuclease
• poly(A)-specific ribonuclease (deadenylation nuclease)
• poly(A)-specific ribonuclease PARN
• Polyadenylate-specific ribonuclease

Background

The protein encoded by this gene is a 3'-exoribonuclease, with similarity to the RNase D family of 3'-exonucleases. It prefers poly(A) as the substrate, hence, efficiently degrades poly(A) tails of mRNAs. Exonucleolytic degradation of the poly(A) tail is often the first step in the decay of eukaryotic mRNAs. This protein is also involved in silencing of certain maternal mRNAs during oocyte maturation and early embryonic development, as well as in nonsense-mediated decay (NMD) of mRNAs that contain premature stop codons. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PARN
• Entrez:
  • 5073(Human)
• Uniprot:
  • NP_002573.1(Human)