PARD6B Antibody

Images

 
Western Blot: PARD6B Antibody [NBP3-10560] - Western blot analysis of PARD6B in Human liver. Antibody dilution at 1 ug/mL

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PARD6B Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of MOUSE PARD6B (NP_067384). Peptide sequence SKFGAEFRRFSLERSKPGKFEEFYGLLQHVHKIPNVDVLVGYADIHGDLL
Clonality
Polyclonal
Host
Rabbit
Gene
PARD6B
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Western Blot 1.0 ug/ml
Theoretical MW
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for PARD6B Antibody

  • par-6 (partitioning defective 6, C.elegans) homolog beta
  • PAR-6 beta
  • par-6 partitioning defective 6 homolog beta (C. elegans)
  • PAR6B
  • PAR-6B
  • partitioning defective 6 homolog beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38487
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67895
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
NBP1-88861
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NB100-314
Species: Hu
Applications: IP, WB
NBP1-85047
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
NBP2-30757
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00002011-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
AF1013
Species: Mu
Applications: IHC, IP, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-67415
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-81746
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF1213
Species: Mu
Applications: Block, ICC, IHC, WB
NBP2-00594
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
MAB6666
Species: Hu
Applications: WB
NBP3-10560
Species: Hu, Mu
Applications: WB, IHC

Publications for PARD6B Antibody (NBP3-10560) (0)

There are no publications for PARD6B Antibody (NBP3-10560).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PARD6B Antibody (NBP3-10560) (0)

There are no reviews for PARD6B Antibody (NBP3-10560). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PARD6B Antibody (NBP3-10560) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PARD6B Products

Bioinformatics Tool for PARD6B Antibody (NBP3-10560)

Discover related pathways, diseases and genes to PARD6B Antibody (NBP3-10560). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PARD6B Antibody (NBP3-10560)

Discover more about diseases related to PARD6B Antibody (NBP3-10560).
 

Pathways for PARD6B Antibody (NBP3-10560)

View related products by pathway.

PTMs for PARD6B Antibody (NBP3-10560)

Learn more about PTMs related to PARD6B Antibody (NBP3-10560).
 

Research Areas for PARD6B Antibody (NBP3-10560)

Find related products by research area.

Blogs on PARD6B

There are no specific blogs for PARD6B, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PARD6B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PARD6B