Recombinant Human PARD3/Par3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PARD3/Par3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 181-290 of Human PARD3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KIKIQESFTSEEERIRMKQEQERIQAKTREFRERQARERDYAEIQDFHRTFGCDDELMYGGVSSYEGSMALNARPQSPREGHMMDALYAQVKKPRNSKPSPVDSNRSTPS

Protein/Peptide Type
Partial Recombinant Protein
Gene
PARD3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PARD3/Par3 Protein

  • ASIP
  • Baz
  • Bazooka
  • FLJ21015
  • par-3 partitioning defective 3 homolog (C. elegans)
  • PAR3
  • PAR3A
  • PAR3C.elegans) homolog
  • PARD3
  • SE2-5L16
  • SE2-5LT1
  • SE2-5T2

Background

PARD3 - par-3 partitioning defective 3 homolog (C. elegans)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NLS261
Species: Hu
Applications: WB (-), IHC-P, ICC
NBP2-38487
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81746
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-49382
Species: Hu
Applications: IHC
H00009002-M01
Species: Hu
Applications: WB, ELISA
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-87338
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-53125
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
MAB3949
Species: Hu
Applications: Flow, CyTOF-ready
NB500-178
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ICC/IF
19540002
Species: Hu
Applications: ELISA, IHC, IHC-P
H00056288-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for PARD3/Par3 Partial Recombinant Protein (H00056288-Q01) (0)

There are no publications for PARD3/Par3 Partial Recombinant Protein (H00056288-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PARD3/Par3 Partial Recombinant Protein (H00056288-Q01) (0)

There are no reviews for PARD3/Par3 Partial Recombinant Protein (H00056288-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PARD3/Par3 Partial Recombinant Protein (H00056288-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PARD3/Par3 Products

Bioinformatics Tool for PARD3/Par3 Partial Recombinant Protein (H00056288-Q01)

Discover related pathways, diseases and genes to PARD3/Par3 Partial Recombinant Protein (H00056288-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PARD3/Par3 Partial Recombinant Protein (H00056288-Q01)

Discover more about diseases related to PARD3/Par3 Partial Recombinant Protein (H00056288-Q01).
 

Pathways for PARD3/Par3 Partial Recombinant Protein (H00056288-Q01)

View related products by pathway.

PTMs for PARD3/Par3 Partial Recombinant Protein (H00056288-Q01)

Learn more about PTMs related to PARD3/Par3 Partial Recombinant Protein (H00056288-Q01).
 

Research Areas for PARD3/Par3 Partial Recombinant Protein (H00056288-Q01)

Find related products by research area.

Blogs on PARD3/Par3

There are no specific blogs for PARD3/Par3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PARD3/Par3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PARD3
Entrez