Recombinant Human PARD3/Par3 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human PARD3/Par3 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 181-290 of Human PARD3/Par3

Source: Wheat Germ

Amino Acid Sequence: KIKIQESFTSEEERIRMKQEQERIQAKTREFRERQARERDYAEIQDFHRTFGCDDELMYGGVSSYEGSMALNARPQSPREGHMMDALYAQVKKPRNSKPSPVDSNRSTPS

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
PARD3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PARD3/Par3 Protein

  • ASIP
  • Baz
  • Bazooka
  • FLJ21015
  • par-3 partitioning defective 3 homolog (C. elegans)
  • PAR3
  • PAR3A
  • PAR3C.elegans) homolog
  • PARD3
  • SE2-5L16
  • SE2-5LT1
  • SE2-5T2

Background

PARD3 - par-3 partitioning defective 3 homolog (C. elegans)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61816
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NLS261
Species: Hu
Applications: WB (-), IHC, IHC-P, ICC
NB300-953
Species: Hu
Applications: WB, Flow, IHC, IHC-P, PEP-ELISA
NBP1-81746
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-49382
Species: Hu
Applications: IHC, IHC-P
NLS1040
Species: Hu, Mk
Applications: IHC, IHC-P
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-87338
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85047
Species: Hu, Mu, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KO
NBP2-67895
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
NBP1-53125
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67233
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-11250
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, IHC, IHC-P, IP
NB500-178
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ICC/IF
19540002
Species: Hu
Applications: ELISA, IHC, IHC-P

Publications for PARD3/Par3 Partial Recombinant Protein (H00056288-Q01) (0)

There are no publications for PARD3/Par3 Partial Recombinant Protein (H00056288-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PARD3/Par3 Partial Recombinant Protein (H00056288-Q01) (0)

There are no reviews for PARD3/Par3 Partial Recombinant Protein (H00056288-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PARD3/Par3 Partial Recombinant Protein (H00056288-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional PARD3/Par3 Products

Bioinformatics Tool for PARD3/Par3 Partial Recombinant Protein (H00056288-Q01)

Discover related pathways, diseases and genes to PARD3/Par3 Partial Recombinant Protein (H00056288-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PARD3/Par3 Partial Recombinant Protein (H00056288-Q01)

Discover more about diseases related to PARD3/Par3 Partial Recombinant Protein (H00056288-Q01).
 

Pathways for PARD3/Par3 Partial Recombinant Protein (H00056288-Q01)

View related products by pathway.

PTMs for PARD3/Par3 Partial Recombinant Protein (H00056288-Q01)

Learn more about PTMs related to PARD3/Par3 Partial Recombinant Protein (H00056288-Q01).
 

Research Areas for PARD3/Par3 Partial Recombinant Protein (H00056288-Q01)

Find related products by research area.

Blogs on PARD3/Par3

There are no specific blogs for PARD3/Par3, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PARD3/Par3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PARD3