PARC Recombinant Protein Antigen

Images

 
There are currently no images for PARC Recombinant Protein Antigen (NBP2-58049PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PARC Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PARC.

Source: E. coli

Amino Acid Sequence: WKPNHKDYYNCSAMVSKAARQEKRFQDYNERCTFHHQAREFAVNLRNRVSAIHEVPPPRSFTFLNDACQGLEQARKVLAYACVYSFYSQDAEYMDVVEQQTENLELHT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CUL9
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58049.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PARC Recombinant Protein Antigen

  • CUL-9
  • cullin 9
  • cullin-9
  • DKFZp686G1042
  • H7AP1DKFZp686P2024
  • p53-associated parkin-like cytoplasmic protein
  • PARCKIAA0708
  • parkin-like cytoplasmic p53 binding protein
  • RP3-330M21.2
  • UbcH7-associated protein 1

Background

PARC is a cytoplasmic anchor protein in p53 associated protein complexes. PARC directly interacted and formed an approximately 1MD complex with p53 in the cytoplasm of unstressed cells. In the absence of stress, inactivation of PARC induced nuclear localization of endogenous p53 and activated p53 dependent apoptosis. Overexpression of PARC promoted cytoplasmic sequestration of ectopic p53. Furthermore, abnormal cytoplasmic localization of p53 was observed in a number of neuroblastoma cell lines; RNA interference-mediated reduction of endogenous PARC significantly sensitized these neuroblastoma cells in the DNA damage response. These results revealed that PARC is a critical regulator in controlling p53 subcellular localization and subsequent function.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-53281
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, PA, WB
DY394
Species: Hu
Applications: ELISA
NBP2-67232
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
DCP00
Species: Hu
Applications: ELISA
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
M6000B
Species: Mu
Applications: ELISA
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
DRN00B
Species: Hu
Applications: ELISA
NBP3-25643
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB7446
Species: Hu
Applications: CyTOF-ready, Flow
NBP1-81746
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-46198
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-41266
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
MCC170
Species: Mu
Applications: ELISA
MMA00
Species: Mu
Applications: ELISA
NB100-695
Species: Fi, Hu, Mu, Rt
Applications: ELISA, IHC, KD, Simple Western, WB
DIP100
Species: Hu
Applications: ELISA

Publications for PARC Recombinant Protein Antigen (NBP2-58049PEP) (0)

There are no publications for PARC Recombinant Protein Antigen (NBP2-58049PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PARC Recombinant Protein Antigen (NBP2-58049PEP) (0)

There are no reviews for PARC Recombinant Protein Antigen (NBP2-58049PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PARC Recombinant Protein Antigen (NBP2-58049PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PARC Products

Research Areas for PARC Recombinant Protein Antigen (NBP2-58049PEP)

Find related products by research area.

Blogs on PARC

There are no specific blogs for PARC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PARC Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CUL9