PAPSS1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PAPSS1 Antibody [NBP2-13730] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli.

Immunohistochemistry-Paraffin: PAPSS1 Antibody [NBP2-13730] - Staining of human smooth muscle shows moderate cytoplasmic positivity in smooth muscle cells.

Simple Western: PAPSS1 Antibody [NBP2-13730] - Lane view shows a specific band for PAPSS1 using 200 ug/mL of HepG2 cell lysate and 1:25 antibody dilution. Electropherogram image of corresponding Simple Western lane view at WES molecular weight of 65 kDa. Image from an internal validation.

• Reactivity: Hu, Mu, Rt
• Applications: Simple Western, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PAPSS1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: QERDIVPVDASYEVKELYVPENKLHLAKTDAETLPALKINKVDMQWVQVLAE
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PAPSS1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Simple Western 1:25
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
  
  See Simple Western Antibody Database for Simple Western validation: Tested in HepG2 lysate, separated by Size, antibody dilution of 1:25, apparent MW was 65 kDa
• Control Peptide:

  PAPSS1 Protein (NBP2-13730PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PAPSS1 Antibody - BSA Free

• 3'-phosphoadenosine 5'-phosphosulfate synthase 1
• ATPSK1SK 1
• bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1
• EC 2.7.1.25
• PAPS synthase 1
• PAPSS 1
• PAPSS3-prime-phosphoadenosine 5-prime-phosphosulfate synthase 1
• SK1
• Sulfurylase kinase 1

Background

Three-prime-phosphoadenosine 5-prime-phosphosulfate (PAPS) is the sulfate donor cosubstrate for all sulfotransferase (SULT) enzymes (Xu et al., 2000 [PubMed 10679223]). SULTs catalyze the sulfate conjugation of many endogenous and exogenous compounds, including drugs and other xenobiotics. In humans, PAPS is synthesized from adenosine 5-prime triphosphate (ATP) and inorganic sulfate by 2 isoforms, PAPSS1 and PAPSS2 (MIM 603005).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PAPSS1