PAPSS1 Antibody


Immunocytochemistry/ Immunofluorescence: PAPSS1 Antibody [NBP2-13730] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: PAPSS1 Antibody [NBP2-13730] - Staining of human smooth muscle shows moderate cytoplasmic positivity in smooth muscle cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications Simple Western, ICC/IF, IHC, IHC-P

Order Details

PAPSS1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: QERDIVPVDASYEVKELYVPENKLHLAKTDAETLPALKINKVDMQWVQVL AE
Specificity of human PAPSS1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Simple Western 1:25
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size.
Control Peptide
PAPSS1 Protein (NBP2-13730PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PAPSS1 Antibody

  • 3'-phosphoadenosine 5'-phosphosulfate synthase 1
  • ATPSK1SK 1
  • bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1
  • EC
  • PAPS synthase 1
  • PAPSS 1
  • PAPSS3-prime-phosphoadenosine 5-prime-phosphosulfate synthase 1
  • SK1
  • Sulfurylase kinase 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, MiAr
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC-P, IF
Species: Hu
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Mu
Applications: Flow, IHC, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Simple Western, ICC/IF, IHC, IHC-P

Publications for PAPSS1 Antibody (NBP2-13730) (0)

There are no publications for PAPSS1 Antibody (NBP2-13730).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAPSS1 Antibody (NBP2-13730) (0)

There are no reviews for PAPSS1 Antibody (NBP2-13730). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PAPSS1 Antibody (NBP2-13730) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for PAPSS1 Antibody (NBP2-13730)

Discover related pathways, diseases and genes to PAPSS1 Antibody (NBP2-13730). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PAPSS1 Antibody (NBP2-13730)

Discover more about diseases related to PAPSS1 Antibody (NBP2-13730).

Pathways for PAPSS1 Antibody (NBP2-13730)

View related products by pathway.

PTMs for PAPSS1 Antibody (NBP2-13730)

Learn more about PTMs related to PAPSS1 Antibody (NBP2-13730).

Blogs on PAPSS1

There are no specific blogs for PAPSS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PAPSS1 Antibody and receive a gift card or discount.


Gene Symbol PAPSS1