Pappalysin-2/PAPP-A2 Antibody

Images

 
Immunohistochemistry: Pappalysin-2/PAPP-A2 Antibody [NBP1-87340] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic and decidua cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Pappalysin-2/PAPP-A2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NPAGLRGAVEEPAAPWVGDSPIGQSELLGDDDAYLGNQRSKESLGEAGIQKGSAMAATTTTAIFTTLNEPKPETQRRGWAKSRQRRQVWKRRAEDGQGDSGISSHFQPWPKH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PAPPA2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Pappalysin-2/PAPP-A2 Protein (NBP1-87340PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Pappalysin-2/PAPP-A2 Antibody

  • EC 3.4.24.-
  • PAPPA2
  • PAPP-A2
  • PAPP-A2pappalysin-2
  • pappalysin 2
  • Pappalysin2
  • Pappalysin-2
  • PAPPE
  • PAPP-E
  • PLAC3
  • placenta-specific 3
  • pregnancy-associated plasma preproprotein-A2
  • Pregnancy-associated plasma protein A2
  • Pregnancy-associated plasma protein E1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2487
Species: Hu
Applications: WB, IP
AF875
Species: Hu
Applications: WB, IHC
NBP1-80549
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB2859
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NB110-58359
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBL1-11228
Species: Hu
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3059
Species: Mu
Applications: WB, Simple Western, ICC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87340
Species: Hu
Applications: IHC, IHC-P

Publications for Pappalysin-2/PAPP-A2 Antibody (NBP1-87340) (0)

There are no publications for Pappalysin-2/PAPP-A2 Antibody (NBP1-87340).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pappalysin-2/PAPP-A2 Antibody (NBP1-87340) (0)

There are no reviews for Pappalysin-2/PAPP-A2 Antibody (NBP1-87340). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Pappalysin-2/PAPP-A2 Antibody (NBP1-87340) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Pappalysin-2/PAPP-A2 Products

Bioinformatics Tool for Pappalysin-2/PAPP-A2 Antibody (NBP1-87340)

Discover related pathways, diseases and genes to Pappalysin-2/PAPP-A2 Antibody (NBP1-87340). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pappalysin-2/PAPP-A2 Antibody (NBP1-87340)

Discover more about diseases related to Pappalysin-2/PAPP-A2 Antibody (NBP1-87340).
 

Pathways for Pappalysin-2/PAPP-A2 Antibody (NBP1-87340)

View related products by pathway.

PTMs for Pappalysin-2/PAPP-A2 Antibody (NBP1-87340)

Learn more about PTMs related to Pappalysin-2/PAPP-A2 Antibody (NBP1-87340).

Blogs on Pappalysin-2/PAPP-A2

There are no specific blogs for Pappalysin-2/PAPP-A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pappalysin-2/PAPP-A2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PAPPA2
Entrez