![Immunohistochemistry-Paraffin: Pappalysin-2/PAPP-A2 Antibody [NBP1-87340] - Analysis in human placenta and prostate tissues using NBP1-87340 antibody. Corresponding PAPPA2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/Pappalysin-2-PAPP-A2-Antibody-Immunohistochemistry-Paraffin-NBP1-87340-img0010.jpg "Immunohistochemistry-Paraffin: Pappalysin-2/PAPP-A2 Antibody [NBP1-87340] - Analysis in human placenta and prostate tissues using NBP1-87340 antibody. Corresponding PAPPA2 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NPAGLRGAVEEPAAPWVGDSPIGQSELLGDDDAYLGNQRSKESLGEAGIQKGSAMAATTTTAIFTTLNEPKPETQRRGWAKSRQRRQVWKRRAEDGQGDSGISSHFQPWPKH |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PAPPA2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
-Immunohistochemistry-Paraffin-NBP3-15896-img0001.jpg)
-Immunohistochemistry-Paraffin-NBP3-15896-img0002.jpg)
-Immunocytochemistry-Immunofluorescence-NBP3-15896-img0003.jpg)
-Flow-Cytometry-NB100-524-img0014.jpg)
-Flow-Cytometry-NB100-524-img0015.jpg)
-Immunohistochemistry-Frozen-NB100-524-img0016.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for Pappalysin-2/PAPP-A2 Antibody (NBP1-87340)Discover more about diseases related to Pappalysin-2/PAPP-A2 Antibody (NBP1-87340).
| Pathways for Pappalysin-2/PAPP-A2 Antibody (NBP1-87340)View related products by pathway.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PAPPA2 |
![Immunohistochemistry-Paraffin: Pappalysin-2/PAPP-A2 Antibody [NBP1-87340] - Staining of human cerebral cortex, liver, placenta and prostate using Anti-PAPPA2 antibody NBP1-87340 (A) shows similar protein distribution across tissues to independent antibody NBP1-87339 (B).](http://images.novusbio.com/fullsize2/Pappalysin-2-PAPP-A2-Antibody-Immunohistochemistry-Paraffin-NBP1-87340-img0009.jpg "Immunohistochemistry-Paraffin: Pappalysin-2/PAPP-A2 Antibody [NBP1-87340] - Staining of human cerebral cortex, liver, placenta and prostate using Anti-PAPPA2 antibody NBP1-87340 (A) shows similar protein distribution across tissues to independent antibody NBP1-87339 (B).")
![Immunohistochemistry-Paraffin: Pappalysin-2/PAPP-A2 Antibody [NBP1-87340] - Staining of human cerebral cortex shows no positivity in neurons as expected.](http://images.novusbio.com/fullsize2/Pappalysin-2-PAPP-A2-Antibody-Immunohistochemistry-Paraffin-NBP1-87340-img0012.jpg "Immunohistochemistry-Paraffin: Pappalysin-2/PAPP-A2 Antibody [NBP1-87340] - Staining of human cerebral cortex shows no positivity in neurons as expected.")
![Immunohistochemistry-Paraffin: Pappalysin-2/PAPP-A2 Antibody [NBP1-87340] - Staining of human prostate shows low expression as expected.](http://images.novusbio.com/fullsize2/Pappalysin-2-PAPP-A2-Antibody-Immunohistochemistry-Paraffin-NBP1-87340-img0004.jpg "Immunohistochemistry-Paraffin: Pappalysin-2/PAPP-A2 Antibody [NBP1-87340] - Staining of human prostate shows low expression as expected.")
![Immunohistochemistry-Paraffin: Pappalysin-2/PAPP-A2 Antibody [NBP1-87340] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize2/Pappalysin-2-PAPP-A2-Antibody-Immunohistochemistry-Paraffin-NBP1-87340-img0011.jpg "Immunohistochemistry-Paraffin: Pappalysin-2/PAPP-A2 Antibody [NBP1-87340] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: Pappalysin-2/PAPP-A2 Antibody [NBP1-87340] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize2/Pappalysin-2-PAPP-A2-Antibody-Immunohistochemistry-Paraffin-NBP1-87340-img0013.jpg "Immunohistochemistry-Paraffin: Pappalysin-2/PAPP-A2 Antibody [NBP1-87340] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Pappalysin-1/PAPP-A [HRP]](https://images.novusbio.com/images2/Pappalysin-1_DPPA00_ELISA_162.jpg)
![Pappalysin-1/PAPP-A [HRP]](https://images.novusbio.com/images2/DATA_Pappalysin1_DPPA00_ELISA_795.jpg)
![Immunohistochemistry VEGFR1/Flt-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/VEGF_R1_AF321_Immunohistochemistry_6778.jpg)
![Immunohistochemistry VEGFR1/Flt-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/VEGF_R1_AF321_Immunohistochemistry_9337.jpg)
![SDS-PAGE IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_40.jpg)
![Bioactivity IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_41.jpg)
![Mass Spectrometry IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_42.jpg)
![Leptin/OB [HRP]](https://images.novusbio.com/images2/Leptin_DLP00_ELISA_134.jpg)
![Leptin/OB [HRP]](https://images.novusbio.com/images2/DATA_Leptin_DLP00_ELISA_749.jpg)
-Western-Blot-H00001392-M02-img0002.jpg)
-Sandwich-ELISA-H00001392-M02-img0001.jpg)
![Immunocytochemistry S100A8 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A8_AF3059_Immunocytochemistry_6489.jpg)
![Western Blot S100A8 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A8_AF3059_Immunocytochemistry__Immunofluorescence_17308.jpg)
![Simple Western S100A8 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A8_AF3059_Simple_Western_18694.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images2/Goat-anti-Rabbit-IgG-(H+L)-Secondary-Antibody-[HRP]-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")