New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

Home » PAOX » PAOX Antibodies » PAOX Antibody

PAOX Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: PAOX Antibody [NBP1-70667] - Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.
Western Blot: PAOX Antibody [NBP1-70667] - Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.
Western Blot: PAOX Antibody [NBP1-70667] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

PAOX Antibody Summary

Immunogen
Synthetic peptides corresponding to PAOX(polyamine oxidase (exo-N4-amino)) The peptide sequence was selected from the middle region of PAOX. Peptide sequence RGSAVGMEGGRPPPQSVGPAGAAAQAQALAGPSLLCSTRVGGRLGPSFLL. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PAOX
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against PAOX and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PAOX Antibody

  • DKFZp434J245
  • MGC45464
  • PAO
  • polyamine oxidase (exo-N4-amino)
  • polyamine oxidase

Background

PAOX belongs to the flavin monoamine oxidase family. PAOX is a flavoenzyme which catalyzes the oxidation of N(1)-acetylspermine to spermidine and is thus involved in the polyamine back-conversion. It can also oxidize N(1)-acetylspermidine to putrescine. PAOX does not oxidize spermidine. It plays an important role in the regulation of polyamine intracellular concentration and has the potential to act as a determinant of cellular sensitivity to the antitumor polyamine analogs.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Recombinant Human
Gastrin GST (N-Term) ...
H00002520-P01
SDS-Page: Recombinant Human Gastrin peptide Protein [H00002520-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
(2 Publications)
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(36 Reviews)
(708 Publications)
Species: Hu
Applications: BA
Ornithine
Decarboxylase Antibod ...
NBP2-32887
Flow Cytometry: Ornithine Decarboxylase Antibody (ODC1/485) [NBP2-32887] - Flow Cytometric Analysis of human ODC-1 in PC3 cells. Black: cells alone; Grey: Isotype Control; Green: AF488-labeled Ornithine Decarboxylase Antibody (ODC1/485).
Immunohistochemistry-Paraffin: Ornithine Decarboxylase Antibody (ODC1/485) [NBP2-32887] - Formalin-fixed, paraffin-embedded Mouse Pancreas stained with Ornithine Decarboxylase Antibody (ODC1/485).
Immunocytochemistry/Immunofluorescence: Ornithine Decarboxylase Antibody (ODC1/485) [NBP2-32887] - IF staining of LNCap cells using AF488 labeled ODC1 Monoclonal Antibody (ODC1/485) (GREEN) DAPI was used to stain the cell nucleus (blue). Image using the Azide and BSA Free format of this antibody.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Insulin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Human/Mouse/Bovine Insulin Monoclonal Antibody (Catalog # MAB1417) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(14 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Lamin B Receptor
Antibody
H00003930-B01P
Western Blot: Lamin B Receptor Antibody [H00003930-B01P] - Expression in Jurkat.
Immunocytochemistry/Immunofluorescence: Lamin B Receptor Antibody [H00003930-B01P] - Analysis of purified antibody to LBR on HeLa cell. (antibody concentration 10 ug/ml)
Immunohistochemistry-Paraffin: Lamin B Receptor Antibody [H00003930-B01P] - Analysis of purified antibody to LBR on formalin-fixed paraffin-embedded human small Intestine. (antibody concentration 3 ug/ml)
(1 Review)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Reg1A Antibody
[Unconjugated]
AF4937
Reg1A was detected in immersion fixed paraffin-embedded sections of human pancreas using Sheep Anti-Human Reg1A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4937) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in exocrine cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of human pancreas tissue. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human Reg1A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4937) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). Specific bands were detected for Reg1A at approximately 20-22 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
Species: Hu
Applications: IHC, WB
Catalase Antibody
[Unconjugated]
AF3398
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, Raji human Burkitt's lymphoma cell line, HeLa human cervical epithelial carcinoma cell line, NIH‑3T3 mouse embryonic fibroblast cell line, A20 mouse B cell lymphoma cell line, andRat‑2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti‑Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Catalase at approximately 64 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 2. 
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line and Raji human Burkitt's lymphoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Catalase at approximately 62 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Catalase knockout HeLa cell line (KO). PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Catalase at approximately 64 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockout HeLa cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(7 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
PTP pi/PTPRU
Antibody (764209)
MAB7475
Western blot shows lysates of human brain (cerebellum) tissue and rat brain tissue. PVDF membrane was probed with 0.5 µg/mL of Mouse Anti-Human PTPπ/PTPRU Monoclonal Antibody (Catalog # MAB7475) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for PTPπ/PTPRU at approximately 180-200 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(2 Reviews)
Species: Hu, Rt
Applications: WB
SLC25A3 Antibody
H00005250-B02P
Immunocytochemistry/Immunofluorescence: SLC25A3 Antibody [H00005250-B02P] - Analysis of purified antibody to SLC25A3 on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: SLC25A3 Antibody [H00005250-B02P] - Analysis of SLC25A3 expression in transfected 293T cell line by SLC25A3 polyclonal antibody. Lane 1: SLC25A3 transfected lysate(39.71 KDa). Lane 2: Non-transfected lysate.
Western Blot: SLC25A3 Antibody [H00005250-B02P] - Analysis of SLC25A3 expression in human pancreas.
Species: Hu
Applications: ICC/IF, WB
SMOX Antibody
NBP2-55775
Western Blot: SMOX Antibody [NBP2-55775] - Analysis in human cell line A-549 and human cell line MCF-7
Immunocytochemistry/Immunofluorescence: SMOX Antibody [NBP2-55775] - Staining of human cell line A549 shows localization to nucleoplasm, nuclear membrane & vesicles. Antibody staining is shown in green.
Species: Hu
Applications: ICC/IF, WB
DAO Antibody
NBP2-92892
Immunocytochemistry/Immunofluorescence: DAO Antibody [NBP2-92892] - Analysis of L929 cells using DAO at dilution of 1:100. Blue: DAPI for nuclear staining.
Western Blot: DAO Antibody [NBP2-92892] - Analysis of extracts of Rat kidney, using DAO antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 1s.
(1 Review)
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Recombinant Human
PRH2 GST (N-Term) Pro ...
H00005555-P01
SDS-Page: Recombinant Human PRH2 Protein [H00005555-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Substance P
Antibody (266815)
MAB4375
Substance P was detected in immersion fixed paraffin-embedded sections of human spinal cord using 8 µg/mL Human/Mouse/Rat Substance P Monoclonal Antibody (Catalog # MAB4375) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific labeling was localized to the spinal cord dorsal horn. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(3 Reviews)
(5 Publications)
Species: Hu, Mu, Rt
Applications: IHC
Pancreatic Amylase
Alpha Antibody (OTI6D ...
NBP1-47659
Immunohistochemistry-Paraffin: Pancreatic Amylase Alpha Antibody (6D4) [NBP1-47659] - Pancreatic Amylase Alpha Antibody (6D4) Staining of paraffin-embedded Adenocarcinoma of breast using anti-Pancreatic Amylase mouse monoclonal antibody.
Immunohistochemistry-Paraffin: Pancreatic Amylase Alpha Antibody (6D4) [NBP1-47659] - Pancreatic Amylase Alpha Antibody (6D4) Staining of paraffin-embedded Adenocarcinoma of ovary using anti-Pancreatic Amylase mouse monoclonal antibody.
Immunohistochemistry-Paraffin: Pancreatic Amylase Alpha Antibody (6D4) [NBP1-47659] - Pancreatic Amylase Alpha Antibody (6D4) Staining of paraffin-embedded Carcinoma of kidney using anti-Pancreatic Amylase mouse monoclonal antibody.
(1 Review)
Species: Hu
Applications: IHC, IHC-P, WB
Pallidin Antibody
(OTI1H9)
NBP2-01763
Western Blot: Pallidin Antibody (1H9) [NBP2-01763] Analysis of extracts (35ug) from 9 different cell lines by using anti-Pallidin monoclonal antibody.
Flow Cytometry: Pallidin Antibody (1H9) [NBP2-01763] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Pallidin antibody, and then analyzed by flow cytometry.
Immunohistochemistry-Paraffin: Pallidin Antibody (1H9) [NBP2-01763] - Staining of paraffin-embedded Human tonsil using anti-Pallidin mouse monoclonal antibody.
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Recombinant Human
PRH1 His Protein
NBP2-23368
SDS-Page: PRH1 Protein [NBP2-23368]
Species: Hu
Applications: PAGE
EPB42 Antibody
(2G12)
H00002038-M01
Western Blot: EPB42 Antibody (2G12) [H00002038-M01] - Analysis of EPB42 expression in transfected 293T cell line by EPB42 monoclonal antibody (M01), clone 2G12.Lane 1: EPB42 transfected lysate(69.5 KDa).Lane 2: Non-transfected lysate.
ELISA: EPB42 Antibody (2G12) [H00002038-M01] - Detection limit for recombinant GST tagged EPB42 is 1 ng/ml as a capture antibody.
Immunocytochemistry/Immunofluorescence: EPB42 Antibody (2G12) [H00002038-M01] - Analysis of monoclonal antibody to EPB42 on HeLa cell . Antibody concentration 10 ug/ml.
Species: Hu
Applications: ELISA, ICC/IF, WB
Insulin Receptor
beta Antibody
NBP2-12793
Immunohistochemistry-Paraffin: Insulin Receptor beta Antibody [NBP2-12793] - Staining shows expression of insulin receptor beta in the Cortex in mouse brain. Dilution 1:500. Image submitted by a verified customer review.
Immunoprecipitation: Insulin Receptor beta Antibody [NBP2-12793] - Samples: Whole cell lysate from HeLa (15 and 50 ug for WB; 1 mg for IP, 20% of IP loaded), 293T (T; 50 ug), Jurkat (J; 50 ug) and mouse NIH3T3 (M; 50 ug) cells. Antibodies: Affinity purified rabbit anti-Insulin Receptor Beta antibody NBP2-12793 used for WB at 0.1 ug/ml (A) and 1 ug/ml (B) and used for IP at 6 ug/mg lysate. Insulin Receptor Beta was also immunoprecipitated by rabbit anti-Insulin Receptor Beta antibody, which recognizes an upstream epitope. Detection: Chemiluminescence with exposure times of 30 seconds (A and B).
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Recombinant Human
Pet1 GST (N-Term) Pro ...
H00054738-Q01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, WB
PAOX Antibody
NBP1-70667
PAOX Antibody
Species: Hu
Applications: WB

Publications for PAOX Antibody (NBP1-70667) (0)

There are no publications for PAOX Antibody (NBP1-70667).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAOX Antibody (NBP1-70667) (0)

There are no reviews for PAOX Antibody (NBP1-70667). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PAOX Antibody (NBP1-70667) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PAOX Products

Array NBP1-70667

Bioinformatics Tool for PAOX Antibody (NBP1-70667)

Discover related pathways, diseases and genes to PAOX Antibody (NBP1-70667). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PAOX Antibody (NBP1-70667)

Discover more about diseases related to PAOX Antibody (NBP1-70667).
 

Pathways for PAOX Antibody (NBP1-70667)

View related products by pathway.

Blogs on PAOX

There are no specific blogs for PAOX, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PAOX Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol PAOX
Entrez
Uniprot