Home » PAOX » PAOX Antibodies » PAOX Antibody

PAOX Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: PAOX Antibody [NBP1-70667] - Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.
Western Blot: PAOX Antibody [NBP1-70667] - Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.
Western Blot: PAOX Antibody [NBP1-70667] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

PAOX Antibody Summary

Immunogen
Synthetic peptides corresponding to PAOX(polyamine oxidase (exo-N4-amino)) The peptide sequence was selected from the middle region of PAOX. Peptide sequence RGSAVGMEGGRPPPQSVGPAGAAAQAQALAGPSLLCSTRVGGRLGPSFLL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PAOX
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PAOX and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PAOX Antibody

  • DKFZp434J245
  • MGC45464
  • PAO
  • polyamine oxidase (exo-N4-amino)
  • polyamine oxidase

Background

PAOX belongs to the flavin monoamine oxidase family. PAOX is a flavoenzyme which catalyzes the oxidation of N(1)-acetylspermine to spermidine and is thus involved in the polyamine back-conversion. It can also oxidize N(1)-acetylspermidine to putrescine. PAOX does not oxidize spermidine. It plays an important role in the regulation of polyamine intracellular concentration and has the potential to act as a determinant of cellular sensitivity to the antitumor polyamine analogs.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Recombinant Human
Gastrin Protein
H00002520-P01
SDS-Page: Recombinant Human Gastrin peptide Protein [H00002520-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
(2 Publications)
Species: Hu
TNF-alpha
[Unconjugated]
210-TA
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(26 Reviews)
(631 Publications)
Species: Hu
Ornithine
Decarboxylase Antibod ...
NBP2-32887
Western Blot: Ornithine Decarboxylase Antibody (ODC1/485) [NBP2-32887] - Analysis using the Azide and BSA Free version of NBP2-32887. Detection of ODC1 in human placental lysate
Immunocytochemistry/Immunofluorescence: Ornithine Decarboxylase Antibody (ODC1/485) [NBP2-32887] - IF staining of LNCap cells using AF488 labeled ODC1 Monoclonal Antibody (ODC1/485) (GREEN) DAPI was used to stain the cell nucleus (blue). Image using the Azide and BSA Free format of this antibody.
Immunohistochemistry-Paraffin: Ornithine Decarboxylase Antibody (ODC1/485) [NBP2-32887] - Formalin-fixed, paraffin-embedded Mouse Pancreas stained with Ornithine Decarboxylase Antibody (ODC1/485).
(1 Review)
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Insulin E2E3, human pancreas (FFPE), HIER pH 9 antigen retrieval. Image from verified customer review.
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
(5 Reviews)
(1 Publication)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Lamin B Receptor
Antibody (BB2SS3F3)
NBP2-59947
Western Blot: Lamin B Receptor Antibody (BB2SS3F3) [NBP2-59947] - Analysis of whole cell lysate from human (Hela) and mouse (C2C12, immortalized mouse adult fibroblasts (MAFs), NIE-115) cell lines were separated on SDS-PAGE gel, transferred to nitrocellulose membrane and blotted with BB2SS3F3 antibody. Both primary and secondary antibodies were diluted in blocking buffer (5% nonfat dry milk resuspended in 0.1% Tween and 1X PBS). The predicted molecular weight is 70.7kDA and 71.4kDa for human and mouse LBR respectively. The absence of a band in LBR null MAFs indicated that the antibody specifically recognizes LBR.
Immunocytochemistry/Immunofluorescence: Lamin B Receptor Antibody (BB2SS3F3) [NBP2-59947] - The antibody specifically detects LBR. Wild-type immortalized mouse adult fibroblast (MAFs LBR+/+) (upper panel) and LBR-null MEFs (MAFs LBR-/-) (lower panel) were methanol fixed and immunofluorescently stained with BB2SS3F3 mouse monoclonal antibody. In LBR-null MEFs there is a loss of BB2SS3F3 antibody staining signal indicating the LBR specific signal of the BB2SS3F3 antibody.
Immunocytochemistry/Immunofluorescence: Lamin B Receptor Antibody (BB2SS3F3) [NBP2-59947] - Staining of mouse small intestine. Small intestine from adult C57BL/6 mice was transferred to OCT compound and frozen in liquid nitrogen. Tissue cryosections were fixed in 10% neutral buffered formalin, permeabilized and stained with anti-LBR BB2SS3F3 antibody.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Reg1A Antibody
AF4937
Western blot shows lysates of human pancreas tissue. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human Reg1A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4937) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). Specific bands were detected for Reg1A at approximately 20-22 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Reg1A was detected in immersion fixed paraffin-embedded sections of human pancreas using Sheep Anti-Human Reg1A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4937) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in exocrine cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: WB, IHC
Catalase Antibody
NBP2-24916
Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
PTP pi/PTPRU
Antibody (764209)
MAB7475
Western blot shows lysates of human brain (cerebellum) tissue and rat brain tissue. PVDF membrane was probed with 0.5 µg/mL of Mouse Anti-Human PTPπ/PTPRU Monoclonal Antibody (Catalog # MAB7475) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for PTPπ/PTPRU at approximately 180-200 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
Species: Hu, Rt
Applications: WB
SLC25A3 Antibody
H00005250-B02P
Western Blot: SLC25A3 Antibody [H00005250-B02P] - Analysis of SLC25A3 expression in human pancreas.
Immunocytochemistry/Immunofluorescence: SLC25A3 Antibody [H00005250-B02P] - Analysis of purified antibody to SLC25A3 on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: SLC25A3 Antibody [H00005250-B02P] - Analysis of SLC25A3 expression in transfected 293T cell line by SLC25A3 polyclonal antibody. Lane 1: SLC25A3 transfected lysate(39.71 KDa). Lane 2: Non-transfected lysate.
Species: Hu
Applications: WB, ICC/IF
SMOX Antibody
NBP2-55775
Western Blot: SMOX Antibody [NBP2-55775] - Analysis in human cell line A-549 and human cell line MCF-7
Immunocytochemistry/Immunofluorescence: SMOX Antibody [NBP2-55775] - Staining of human cell line A549 shows localization to nucleoplasm, nuclear membrane & vesicles. Antibody staining is shown in green.
Species: Hu
Applications: WB, ICC/IF
DAO Antibody
NBP1-84304
Western Blot: DAO Antibody [NBP1-84304] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunohistochemistry-Paraffin: DAO Antibody [NBP1-84304] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: DAO Antibody [NBP1-84304] - Staining of human kidney shows high expression.
Species: Hu
Applications: WB, IHC, IHC-P
Recombinant Human
PRH2 Protein
H00005555-P01
SDS-Page: Recombinant Human PRH2 Protein [H00005555-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Substance P
Antibody
NB300-187
Immunocytochemistry/Immunofluorescence: Substance P Antibody [NB300-187] - Staining of trigeminal ganglia from P3-P5 rat pups. BMC Neuroscience 2010, 11:32doi:10.1186/1471-2202-11-32
Immunohistochemistry: Substance P Antibody [NB300-187] - Spinal Cord Dorsal Horn (Human).
Immunocytochemistry/Immunofluorescence: Substance P Antibody [NB300-187] - Detection of Substance P in rat spinal cord dorsal horn (red fluorescence). DAPI (blue) was used as counter stain.
(7 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
Pancreatic Amylase
Alpha Antibody (OTI6D ...
NBP1-47659
Western Blot: Pancreatic Amylase Alpha Antibody (6D4) [NBP1-47659] - Pancreatic Amylase Alpha Antibody (6D4) HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Pancreatic Amylase(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Pancreatic Amylase.
Immunohistochemistry-Paraffin: Pancreatic Amylase Alpha Antibody (6D4) [NBP1-47659] - Pancreatic Amylase Alpha Antibody (6D4) Staining of paraffin-embedded ovary using anti-Pancreatic Amylase mouse monoclonal antibody.
Immunohistochemistry-Paraffin: Pancreatic Amylase Alpha Antibody (6D4) [NBP1-47659] - Pancreatic Amylase Alpha Antibody (6D4) Staining of paraffin-embedded Adenocarcinoma of breast using anti-Pancreatic Amylase mouse monoclonal antibody.
(1 Review)
Species: Hu
Applications: WB, IHC, IHC-P
Pallidin Antibody
(OTI1H9)
NBP2-01763
Western Blot: Pallidin Antibody (1H9) [NBP2-01763] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Pallidin (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Pallidin.
Immunohistochemistry-Paraffin: Pallidin Antibody (1H9) [NBP2-01763] - Staining of paraffin-embedded Human tonsil using anti-Pallidin mouse monoclonal antibody.
Flow Cytometry: Pallidin Antibody (1H9) [NBP2-01763] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Pallidin antibody, and then analyzed by flow cytometry.
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
Recombinant Human
PRH1 Protein
NBP2-23368
SDS-Page: PRH1 Protein [NBP2-23368]
Species: Hu
EPB42 Antibody
(2G12)
H00002038-M01
Western Blot: EPB42 Antibody (2G12) [H00002038-M01] - Analysis of EPB42 expression in transfected 293T cell line by EPB42 monoclonal antibody (M01), clone 2G12.Lane 1: EPB42 transfected lysate(69.5 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: EPB42 Antibody (2G12) [H00002038-M01] - Analysis of monoclonal antibody to EPB42 on HeLa cell. Antibody concentration 10 ug/ml.
ELISA: EPB42 Antibody (2G12) [H00002038-M01] - Detection limit for recombinant GST tagged EPB42 is 1 ng/ml as a capture antibody.
Species: Hu
Applications: WB, ELISA, ICC/IF
Insulin Receptor
beta Antibody
NBP2-12793
Immunohistochemistry-Paraffin: Insulin Receptor beta Antibody [NBP2-12793] - Staining shows expression of insulin receptor beta in the Cortex in mouse brain. Dilution 1:500
Immunoprecipitation: Insulin Receptor beta Antibody [NBP2-12793] - Samples: Whole cell lysate from HeLa (15 and 50 ug for WB; 1 mg for IP, 20% of IP loaded), 293T (T; 50 ug), Jurkat (J; 50 ug) and mouse NIH3T3 (M; 50 ug) cells. Antibodies: Affinity purified rabbit anti-Insulin Receptor Beta antibody NBP2-12793 used for WB at 0.1 ug/ml (A) and 1 ug/ml (B) and used for IP at 6 ug/mg lysate. Insulin Receptor Beta was also immunoprecipitated by rabbit anti-Insulin Receptor Beta antibody, which recognizes an upstream epitope. Detection: Chemiluminescence with exposure times of 30 seconds (A and B).
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Recombinant Human
Pet1 Protein
H00054738-Q01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
PAOX Antibody
NBP1-70667
PAOX Antibody
Species: Hu
Applications: WB

Publications for PAOX Antibody (NBP1-70667) (0)

There are no publications for PAOX Antibody (NBP1-70667).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAOX Antibody (NBP1-70667) (0)

There are no reviews for PAOX Antibody (NBP1-70667). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PAOX Antibody (NBP1-70667) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional PAOX Products

Array NBP1-70667

Bioinformatics Tool for PAOX Antibody (NBP1-70667)

Discover related pathways, diseases and genes to PAOX Antibody (NBP1-70667). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PAOX Antibody (NBP1-70667)

Discover more about diseases related to PAOX Antibody (NBP1-70667).
 

Pathways for PAOX Antibody (NBP1-70667)

View related products by pathway.

Blogs on PAOX

There are no specific blogs for PAOX, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PAOX Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol PAOX
Entrez
Uniprot
Novus 100% Guarantee