PANK2 Antibody


Western Blot: PANK2 Antibody [NBP2-87951] - Host: Rabbit. Target Name: PANK2. Sample Type: COLO205 Whole Cell lysates. Antibody Dilution: 1.0ug/mlPANK2 is supported by BioGPS gene expression data to be expressed in more

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

PANK2 Antibody Summary

The immunogen is a synthetic peptide directed towards the middle region of HUMAN PANK2. Peptide sequence: FGLPGWAVASSFGNMMSKEKREAVSKEDLARATLITITNNIGSIARMCAL The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified

Alternate Names for PANK2 Antibody

  • C20orf48
  • EC
  • FLJ11729
  • FLJ17232
  • Hallervorden-Spatz syndrome
  • HARPFLJ11729
  • HPANK2
  • HSS
  • MGC15053
  • NBIA1
  • PANK2
  • pantothenate kinase 2
  • pantothenate kinase 2, mitochondrial
  • Pantothenic acid kinase 2
  • PKAN
  • PKANneurodegeneration with brain iron accumulation 1 (Hallervorden-Spatz syndrome)


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB

Publications for PANK2 Antibody (NBP2-87951) (0)

There are no publications for PANK2 Antibody (NBP2-87951).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PANK2 Antibody (NBP2-87951) (0)

There are no reviews for PANK2 Antibody (NBP2-87951). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PANK2 Antibody (NBP2-87951) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PANK2 Products

Bioinformatics Tool for PANK2 Antibody (NBP2-87951)

Discover related pathways, diseases and genes to PANK2 Antibody (NBP2-87951). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PANK2 Antibody (NBP2-87951)

Discover more about diseases related to PANK2 Antibody (NBP2-87951).

Pathways for PANK2 Antibody (NBP2-87951)

View related products by pathway.

PTMs for PANK2 Antibody (NBP2-87951)

Learn more about PTMs related to PANK2 Antibody (NBP2-87951).

Blogs on PANK2

There are no specific blogs for PANK2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PANK2 Antibody and receive a gift card or discount.


Gene Symbol PANK2