Pancreatic Lipase Antibody


Western Blot: Pancreatic Lipase Antibody [NBP1-58034] - Jurkat cell lysate, Antibody Titration: 1.0ug/ml
Immunohistochemistry-Paraffin: Pancreatic Lipase Antibody [NBP1-58034] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Pancreatic Lipase Antibody Summary

Synthetic peptides corresponding to PNLIP (pancreatic lipase) The peptide sequence was selected from the C terminal of PNLIP. Peptide sequence GHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVSVTLSGKKVTGHILV.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against PNLIP and was validated on Western Blot and immunohistochemistry-paraffin

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Pancreatic Lipase Antibody

  • EC
  • EC
  • pancreatic lipasepancreatic triacylglycerol lipase
  • PL
  • PTL
  • triacylglycerol acylhydrolase


PNLIP is a member of the lipase gene family. PNLIP is a carboxyl esterase that hydrolyzes insoluble, emulsified triglycerides, and is essential for the efficient digestion of dietary fats. It is expressed specifically in the pancreas.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, ICC
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu, Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Species: Hu
Applications: WB, IP
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
Species: Mu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Mu
Applications: WB

Publications for Pancreatic Lipase Antibody (NBP1-58034) (0)

There are no publications for Pancreatic Lipase Antibody (NBP1-58034).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pancreatic Lipase Antibody (NBP1-58034) (0)

There are no reviews for Pancreatic Lipase Antibody (NBP1-58034). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Pancreatic Lipase Antibody (NBP1-58034) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Pancreatic Lipase Products

Bioinformatics Tool for Pancreatic Lipase Antibody (NBP1-58034)

Discover related pathways, diseases and genes to Pancreatic Lipase Antibody (NBP1-58034). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pancreatic Lipase Antibody (NBP1-58034)

Discover more about diseases related to Pancreatic Lipase Antibody (NBP1-58034).

Pathways for Pancreatic Lipase Antibody (NBP1-58034)

View related products by pathway.

PTMs for Pancreatic Lipase Antibody (NBP1-58034)

Learn more about PTMs related to Pancreatic Lipase Antibody (NBP1-58034).

Blogs on Pancreatic Lipase

There are no specific blogs for Pancreatic Lipase, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Pancreatic Lipase Antibody and receive a gift card or discount.


Gene Symbol PNLIP
COVID-19 update