PAN3 Antibody


Western Blot: PAN3 Antibody [NBP2-85439] - Host: Rabbit. Target Name: PAN3. Sample Tissue: Human Stomach Tumor lysates. Antibody Dilution: 1ug/ml

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

PAN3 Antibody Summary

The immunogen is a synthetic peptide directed towards the middle region of human PAN3. Peptide sequence: LHSPKITPHTSPAPRRRSHTPNPASYMVPSSASTSVNNPVSQTPSSGQVI The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified

Alternate Names for PAN3 Antibody

  • hPan3
  • PAB-dependent poly(A)-specific ribonuclease subunit 3
  • PABP1-dependent poly A-specific ribonuclease subunit PAN3
  • PABP-dependent poly(A) nuclease 3
  • PAN3 poly(A) specific ribonuclease subunit homolog (S. cerevisiae)
  • TS


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Flow, CyTOF-ready
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
Species: Hu
Applications: WB, ICC/IF, IP
Species: Hu
Applications: Flow, CyTOF-reported
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IB, IP, KD
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IP, KD
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Ma
Applications: WB, ICC/IF, IP
Species: Hu
Applications: WB

Publications for PAN3 Antibody (NBP2-85439) (0)

There are no publications for PAN3 Antibody (NBP2-85439).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAN3 Antibody (NBP2-85439) (0)

There are no reviews for PAN3 Antibody (NBP2-85439). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PAN3 Antibody (NBP2-85439) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional PAN3 Products

Array NBP2-85439

Bioinformatics Tool for PAN3 Antibody (NBP2-85439)

Discover related pathways, diseases and genes to PAN3 Antibody (NBP2-85439). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PAN3 Antibody (NBP2-85439)

Discover more about diseases related to PAN3 Antibody (NBP2-85439).

Pathways for PAN3 Antibody (NBP2-85439)

View related products by pathway.

PTMs for PAN3 Antibody (NBP2-85439)

Learn more about PTMs related to PAN3 Antibody (NBP2-85439).

Research Areas for PAN3 Antibody (NBP2-85439)

Find related products by research area.

Blogs on PAN3

There are no specific blogs for PAN3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PAN3 Antibody and receive a gift card or discount.


Gene Symbol PAN3