PALS1/MPP5 Antibody

Images

 
Immunohistochemistry-Paraffin: PALS1/MPP5 Antibody [NBP1-83716] - Staining of human lymph node.
Immunohistochemistry-Paraffin: PALS1/MPP5 Antibody [NBP1-83716] - Staining of human retina shows positivity in outer limiting membrane.
Independent Antibodies: Immunohistochemistry-Paraffin: PALS1/MPP5 Antibody [NBP1-83716] - Staining of human colon, eye, retina, kidney and lymph node using Anti-MPP5 antibody NBP1-83716 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: PALS1/MPP5 Antibody [NBP1-83716] - Staining of human kidney.
Immunohistochemistry-Paraffin: PALS1/MPP5 Antibody [NBP1-83716] - Staining of human colon.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

PALS1/MPP5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EDMRRRREEEGKKQELDLNSSMRLKKLAQIPPKTGIDNPMFDTEEGIVLESPHYAVKILEIEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNKDFQNAFKIHNAITVHMNKASPPFPLISNAQDLAQEVQTVLKPVHHKEGQELTAL
Specificity
Specificity of human PALS1/MPP5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MPP5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control
PALS1/MPP5 Knockout HeLa Cell Lysate
Control Peptide
PALS1/MPP5 Protein (NBP1-83716PEP)
Publications
Read Publication using NBP1-83716.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PALS1/MPP5 Antibody

  • MAGUK p55 subfamily member 5
  • membrane protein, palmitoylated 5 (MAGUK p55 subfamily member 5)
  • MPP5
  • PALS1
  • PALS1FLJ12615
  • Stardust

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1354
Species: Hu
Applications: Flow, PEP-ELISA, IF
NBP2-56113
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81185
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-88861
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-87839
Species: Hu
Applications: IHC, IHC-P
NBP2-38487
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85047
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KO
NBP2-38696
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB6668
Species: Hu
Applications: WB, CyTOF-ready, ICC, ICFlow
NBP2-14193
Species: Hu
Applications: IHC, IHC-P
H00004354-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, S-ELISA
NBP2-15016
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19388
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80518
Species: Hu
Applications: WB
NBP2-94240
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-87365
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83716
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for PALS1/MPP5 Antibody (NBP1-83716)(1)

Reviews for PALS1/MPP5 Antibody (NBP1-83716) (0)

There are no reviews for PALS1/MPP5 Antibody (NBP1-83716). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PALS1/MPP5 Antibody (NBP1-83716) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PALS1/MPP5 Products

Bioinformatics Tool for PALS1/MPP5 Antibody (NBP1-83716)

Discover related pathways, diseases and genes to PALS1/MPP5 Antibody (NBP1-83716). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PALS1/MPP5 Antibody (NBP1-83716)

Discover more about diseases related to PALS1/MPP5 Antibody (NBP1-83716).
 

Pathways for PALS1/MPP5 Antibody (NBP1-83716)

View related products by pathway.

PTMs for PALS1/MPP5 Antibody (NBP1-83716)

Learn more about PTMs related to PALS1/MPP5 Antibody (NBP1-83716).

Blogs on PALS1/MPP5

There are no specific blogs for PALS1/MPP5, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PALS1/MPP5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MPP5
Entrez
Uniprot