PALB2 Recombinant Protein Antigen

Images

 
There are currently no images for PALB2 Recombinant Protein Antigen (NBP2-55028PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PALB2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PALB2.

Source: E.coli

Amino Acid Sequence: YDKLHIKTHLDEETGEKTSITLDVGPESFNPGDGPGGLPIQRTDDTQEHFPHRVSDPSGEQKQKLPSRRKKQQKRTFISQERDCVFGTDSL

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PALB2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-55028 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for PALB2 Recombinant Protein Antigen

  • DKFZp667I166
  • DKFZp686E1054
  • FANCNFLJ21816
  • partner and localizer of BRCA2
  • PNCA3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2476
Species: Hu
Applications: WB, IHC
NB100-416
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP1-92139
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1626
Species: Hu
Applications: WB, ICC
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB100-2564
Species: Hu
Applications: WB
NB100-148
Species: Hu, Mu, Rt, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00414899-T01
Species: Hu
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi, ICC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5776
Species: Hu
Applications: WB, IHC
H00054967-P01
Species: Hu
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB100-143
Species: Hu, Mu, Ha, Ma, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KO
NB100-147
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready

Publications for PALB2 Recombinant Protein Antigen (NBP2-55028PEP) (0)

There are no publications for PALB2 Recombinant Protein Antigen (NBP2-55028PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PALB2 Recombinant Protein Antigen (NBP2-55028PEP) (0)

There are no reviews for PALB2 Recombinant Protein Antigen (NBP2-55028PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for PALB2 Recombinant Protein Antigen (NBP2-55028PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for PALB2 Recombinant Protein Antigen (NBP2-55028PEP)

Discover related pathways, diseases and genes to PALB2 Recombinant Protein Antigen (NBP2-55028PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PALB2 Recombinant Protein Antigen (NBP2-55028PEP)

Discover more about diseases related to PALB2 Recombinant Protein Antigen (NBP2-55028PEP).
 

Pathways for PALB2 Recombinant Protein Antigen (NBP2-55028PEP)

View related products by pathway.

PTMs for PALB2 Recombinant Protein Antigen (NBP2-55028PEP)

Learn more about PTMs related to PALB2 Recombinant Protein Antigen (NBP2-55028PEP).
 

Research Areas for PALB2 Recombinant Protein Antigen (NBP2-55028PEP)

Find related products by research area.

Blogs on PALB2.

The recent relationship of BRCA1 and 53BP1
The p53-binding protein 1 (53BP1) is a DNA damage response factor, which is recruited to nuclear structures at the site of DNA damage.  DNA double-strand breaks (DSBs) are mutations that are detrimental to cell viability and genome stability, and m...  Read full blog post.

Customers Who Bought This Also Bought

Nbs1 Antibody
NB100-143
PALB2 Antibody
21340002-0.1mg
FANCD2 Antibody
NB100-182

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PALB2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PALB2