PAK3 Antibody (0K1I5)

Images

 
Western Blot: PAK3 Antibody (0K1I5) [NBP3-16173] - Western blot analysis of extracts of various cell lines, using PAK3 Rabbit mAb (NBP3-16173) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at ...read more
Immunohistochemistry-Paraffin: PAK3 Antibody (0K1I5) [NBP3-16173] - Immunohistochemistry of paraffin-embedded mouse brain using PAK3 Rabbit mAb (NBP3-16173) at dilution of 1:100 (40x lens).Perform microwave antigen ...read more
Immunohistochemistry-Paraffin: PAK3 Antibody (0K1I5) [NBP3-16173] - Immunohistochemistry of paraffin-embedded rat brain using PAK3 Rabbit mAb (NBP3-16173) at dilution of 1:100 (40x lens).Perform microwave antigen ...read more

Product Details

Summary
Reactivity Mu, RtSpecies Glossary
Applications WB, IHC
Clone
0K1I5
Clonality
Monoclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PAK3 Antibody (0K1I5) Summary

Additional Information
Recombinant Monoclonal Antibody
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PAK3 (O75914). MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTPDLYGSQM
Isotype
IgG
Clonality
Monoclonal
Host
Rabbit
Gene
PAK3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS, 0.05% BSA, 50% glycerol, pH7.3
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PAK3 Antibody (0K1I5)

  • beta-PAK
  • bPAK
  • CDKN1A
  • EC 2.7.11
  • EC 2.7.11.1
  • hPAK3
  • mental retardation, X-linked 47
  • MRX30
  • MRX47
  • oligophrenin-3
  • OPHN3
  • p21 (CDKN1A)-activated kinase 3
  • p21 protein (Cdc42/Rac)-activated kinase 3
  • p21-activated kinase 3
  • PAK3
  • PAK-3
  • PAK3beta
  • serine/threonine-protein kinase PAK 3

Background

p21-activated kinase 3 (PAK3) is a member of a family of serine/threonine protein kinase defined by their interaction with the small GTPases, Cdc42 and Rac (1-2). The PAK proteins can be essentially divided into two categories, group I (PAK1, PAK2 and PAK3) and group II (PAK4, PAK5 and PAK6), based on their structures (3). All six PAKs play an important role in diverse cellular processes, including cytoskeletal dynamics, growth/apoptotic signal transduction through MAP kinases, and regulation of transcription factors (4). PAK3 as well as PAK1 are mostly expressed in the nervous system and particularly in the hippocampus, in which they show a diffuse distribution throughout the soma and proximal dendrites (5). Mutations in PAK3 have been linked to nonsyndromic X-linked mental retardation (6).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46085
Species: Hu
Applications: IHC, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-68858
Species: Hu
Applications: IHC, IHC-P
NBP2-00776
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF1555
Species: Hu
Applications: WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NB300-709
Species: Hu, Pm
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
NBP1-90949
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-47561
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-03198
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-31308
Species: Bv, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NB100-56598
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, KD, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB100-2736
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
MAB7557
Species: Hu
Applications: IHC, WB
NBP3-16173
Species: Mu, Rt
Applications: WB, IHC

Publications for PAK3 Antibody (NBP3-16173) (0)

There are no publications for PAK3 Antibody (NBP3-16173).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAK3 Antibody (NBP3-16173) (0)

There are no reviews for PAK3 Antibody (NBP3-16173). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PAK3 Antibody (NBP3-16173) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PAK3 Antibody (0K1I5) and receive a gift card or discount.

Bioinformatics

Gene Symbol PAK3