PAK2 Antibody

Images

 
Western Blot: PAK2 Antibody [H00005062-D01P] - Analysis of PAK2 expression in transfected 293T cell line by PAK2 polyclonal antibody.Lane 1: PAK2 transfected lysate(58.00 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PAK2 Antibody Summary

Immunogen
PAK2 (NP_002568.2, 1 a.a. - 524 a.a.) full-length human protein. MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRHKIISIFSGTEKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTEAPAVVTEEEDDDEETAPPVIAPRPDHTKSIYTRSVIDPVPAPVGDSHVDGAAKSLDKQKKKTKMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR
Specificity
Reacts with p21 protein (Cdc42/Rac)-activated kinase 2.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PAK2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PAK2 Antibody

  • EC 2.7.11
  • gamma-PAK
  • p21 (CDKN1A)-activated kinase 2
  • p21 protein (Cdc42/Rac)-activated kinase 2
  • p21-activated kinase 2
  • p58
  • PAK2
  • PAK-2
  • PAK65
  • PAK65EC 2.7.11.1
  • PAKgamma
  • S6/H4 Kinase
  • serine/threonine-protein kinase PAK 2

Background

The p21 activated kinases (PAK) are critical effectors that link Rho GTPases to cytoskeleton reorganization and nuclear signaling. The PAK proteins are a family of serine/threonine kinases that serve as targets for the small GTP binding proteins, CDC42 and RAC1, and have been implicated in a wide range of biological activities. The protein encoded by this gene is activated by proteolytic cleavage during caspase-mediated apoptosis, and may play a role in regulating the apoptotic events in the dying cell. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56159
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-85802
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-48704
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-03381
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB2014
Species: Hu
Applications: Flow, CyTOF-reported
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB1058
Species: Hu
Applications: Flow, Block, CyTOF-ready
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF6897
Species: Hu, Mu
Applications: WB, IHC
NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF

Publications for PAK2 Antibody (H00005062-D01P) (0)

There are no publications for PAK2 Antibody (H00005062-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAK2 Antibody (H00005062-D01P) (0)

There are no reviews for PAK2 Antibody (H00005062-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PAK2 Antibody (H00005062-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PAK2 Products

Bioinformatics Tool for PAK2 Antibody (H00005062-D01P)

Discover related pathways, diseases and genes to PAK2 Antibody (H00005062-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PAK2 Antibody (H00005062-D01P)

Discover more about diseases related to PAK2 Antibody (H00005062-D01P).
 

Pathways for PAK2 Antibody (H00005062-D01P)

View related products by pathway.

PTMs for PAK2 Antibody (H00005062-D01P)

Learn more about PTMs related to PAK2 Antibody (H00005062-D01P).
 

Research Areas for PAK2 Antibody (H00005062-D01P)

Find related products by research area.

Blogs on PAK2

There are no specific blogs for PAK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PAK2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PAK2
Entrez
Uniprot